SecReT6
Protein ID: 260597013
SecReT6 ID363
T6SS typeN/A
Gene symbol-
Locus tagCTU_12210
StrainCronobacter turicensis z3032
Repliconchromosome [GenBank: NC_013282] [Browse all T6SS(s) in this replicon]
Location [Strand]1280672..1284457 [+]
Producthypothetical protein
NoteTssM
UniProt IDC9XYL6
KEGG IDctu:CTU_12210
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 2.30E-78, Aligned region: 580..892
ImcF-related_N [PF14331], Evalue: 7.20E-66, Aligned region: 249..533
ImcF-related_N [PF14331], Evalue: 7.20E-66, Aligned region: 613..638
DUF1215 [PF06744], Evalue: 7.30E-25, Aligned region: 1006..1106
AAA_16 [PF13191], Evalue: 0.00095, Aligned region: 175..300
AAA_16 [PF13191], Evalue: 0.00095, Aligned region: 724..755
Protein Sequence: 1261 a.a.     [Download]
>gi|260597013|ref|YP_003209584.1| unnamed protein product [Cronobacter turicensis z3032]
MTFLNRLFSGRSLTFLLMAAWFFLMACAIGYLGPYIGFGEARPFAPAGARLLFIVLALLWLVALWYGIPL
CLPGALTVCAAIWVAGPYVLIGERYPLQRAAIRLAAIAVIMTLVLLYAAWRLLLFTLNNPAWIEKLRFRK
NASTPNAAISEVARIIRDAQKFSRRMYAQENRWRRFFSARTGRDAPPCWLVLGPEGAGKTSLVLSSGQEF
PLPEQLNRTGKENPPTASCECFFANDALFIDTSGKYVSQAGENRQEWQGLLQAIRKYRPATGINGALLAF
SARDILGLPRTQQLELAATLRARLEDLRTTLGACFPVYLIVTKIDELTGFDAWFRHLTAQEREQVWGVTF
PWGGAKGAPTPENAIADELRLLENRLCNAVSVRHQEEYAVADRKKMYAVPQDFRLLAQSLTALARPIFFA
SRYDETQVYSSLRGVYFTSSCQPESLTLRNSTTLVQTWRQSVTQAGIDASVCLPEATPEDERPGPEVVWG
KRYFLRRLFADIMIKDAGLVRYNLRAQSTYRVRNLAGHVVCLTLCFFLARGVLTSYAHNRDYLEAVSRHA
KQLQREVHAFINTRDLPLLPTLLNTARDLAAFPGLATDDPETAWRYGLYTGAAVSQQADTLYHYFLQRLL
FPLIERDATARLNDALQGGDQIRLFDALKRYLMLTGEERFDLNYLIDSITHAWSENGKIAAFEEKAVFID
HLNALFSQPEWRRFGQPRDENLVRAARKRLAQTTLTTRLWGRVRDQLEADAPQDLTLDQLAGESSAHIFT
LSDKALLARGIPGLYTQEGYHQIVKKKLPLLLTSAFQDDRWIMGNDQAGLINPIMLRNDVLVRYLDEYAG
YWERLLNGVTLLPVDAAQSAGMAPNIFMLRTLAAANSPLVSLVREAVKQTTLTAKGPDIAETLNLTNRSA
LLSNAKRVNDQLAFQERRLLQERVDNRFAALREFYSGSPQPDAKTGSVSVMPGSAFNRVIGELNDQYTLF
VMYDNALQAGEPPALSEAARRLAVESDTWPAPLKNIIAPLLNHSFQKVEGETLTQQQGAIAAGPGELCRR
GIEGRYPLSDSDQEISLNQFERFFGAGGALDAYFQAHLADSVDTTASPWHYKGRAQGEGLGLFEQGTALR
SALFQGENGRKVALDLSVAVVYMDPSITRLQMQFDDVAAEYSHGPVTPLFFHWPGGQSANPIRLSAWPAQ
KSATSELSLEGPWSLLHWVDTASQVRQTPDGKTILTFLLNKRRVDFEVTGLNWAGRFVPDLLKSFTCPAA
A
 
Nucleotide Sequence: 3786 bp     [Download]
>gi|325295716|ref|NC_013282.2|:1280672-1284457 Cronobacter turicensis z3032 chromosome, complete genome
ATGACTTTTTTGAATCGGTTATTTTCCGGTCGGTCTTTAACATTCCTGCTGATGGCGGCCTGGTTTTTTC
TTATGGCCTGCGCGATTGGATATCTGGGGCCCTATATCGGTTTTGGCGAGGCGCGGCCTTTTGCCCCGGC
GGGCGCGCGCCTGCTGTTTATTGTGCTCGCGCTCCTGTGGCTCGTCGCGCTCTGGTATGGCATTCCGCTC
TGCCTGCCTGGCGCGTTAACCGTCTGTGCAGCCATCTGGGTCGCGGGGCCTTATGTGCTGATCGGGGAGC
GCTATCCGTTACAGCGCGCGGCAATCCGGCTGGCTGCTATCGCGGTCATTATGACGCTGGTGCTTCTTTA
TGCGGCCTGGCGGCTGTTGCTGTTCACGCTTAATAATCCTGCATGGATTGAGAAGTTACGCTTTCGCAAA
AACGCCTCCACGCCTAATGCGGCGATCTCAGAAGTGGCGCGTATCATCCGGGACGCGCAAAAATTCAGTC
GCCGCATGTACGCGCAGGAAAACCGCTGGCGTCGTTTTTTTTCTGCGCGAACCGGGCGCGACGCACCGCC
TTGTTGGCTCGTTCTTGGCCCGGAAGGCGCGGGAAAAACCTCGCTGGTTCTCTCATCGGGGCAGGAATTT
CCGCTACCCGAGCAGTTAAACCGCACCGGTAAAGAAAATCCGCCCACCGCCAGTTGCGAATGCTTTTTCG
CCAATGACGCGCTTTTTATTGATACCTCGGGCAAATATGTCAGTCAGGCGGGCGAGAATCGCCAGGAATG
GCAGGGGTTGCTACAGGCTATACGTAAATATCGCCCGGCGACAGGCATCAACGGCGCGCTCCTGGCATTC
TCCGCGCGCGATATTCTGGGCCTGCCCCGGACGCAGCAACTGGAACTTGCCGCCACGCTGCGCGCGCGTC
TTGAGGATTTACGCACGACCCTGGGCGCGTGCTTTCCCGTTTATCTTATCGTGACGAAAATCGATGAGCT
GACCGGATTTGACGCCTGGTTTCGTCACTTAACCGCTCAGGAACGCGAACAGGTATGGGGCGTGACGTTT
CCGTGGGGAGGCGCGAAAGGCGCTCCGACGCCTGAGAATGCTATCGCCGATGAGCTGCGGCTGCTGGAGA
ACAGGCTTTGCAATGCGGTCAGTGTTCGTCACCAGGAAGAGTACGCCGTGGCGGACAGAAAAAAAATGTA
CGCGGTTCCGCAGGATTTTCGGTTGCTCGCACAGAGCCTCACGGCGCTGGCGCGCCCCATTTTCTTCGCC
TCCCGCTATGACGAGACGCAGGTTTACAGCAGCCTGCGCGGGGTCTATTTCACCAGCAGCTGCCAGCCGG
AAAGCCTGACGCTTCGCAACAGTACGACGCTGGTGCAGACGTGGCGGCAGTCGGTAACGCAAGCGGGCAT
CGACGCCAGCGTCTGCCTGCCAGAGGCGACACCTGAAGACGAACGGCCCGGCCCGGAGGTGGTGTGGGGA
AAACGCTATTTTTTGCGGCGGCTTTTCGCTGACATCATGATTAAAGATGCGGGCCTCGTGCGCTATAACC
TGCGGGCGCAGTCAACGTATCGCGTTCGCAATCTCGCCGGTCACGTTGTCTGTTTAACGCTGTGCTTTTT
CCTCGCCAGGGGAGTGTTAACGAGCTATGCGCACAACCGCGACTACCTTGAGGCGGTCAGCCGCCACGCG
AAGCAGCTACAGCGTGAAGTTCACGCTTTTATTAACACGCGCGATCTTCCGCTGTTGCCGACACTGTTAA
ATACGGCCCGCGATCTTGCCGCGTTTCCGGGGCTTGCTACGGACGATCCGGAGACGGCGTGGCGCTACGG
GCTGTATACCGGGGCCGCCGTTTCACAACAGGCCGACACGTTGTATCACTATTTTCTGCAACGCCTGCTG
TTCCCGCTGATTGAGCGCGATGCGACAGCGCGTCTTAACGACGCGCTTCAGGGCGGCGATCAGATACGCC
TCTTCGACGCTCTGAAGCGTTACCTGATGCTGACCGGCGAGGAGCGGTTCGATCTCAATTATCTCATCGA
CAGCATTACACACGCCTGGAGTGAGAACGGGAAAATCGCGGCTTTCGAAGAGAAAGCGGTCTTTATCGAT
CATCTGAATGCGTTGTTCTCACAGCCGGAATGGCGGCGCTTCGGCCAGCCGCGCGATGAAAATCTGGTCA
GGGCAGCGCGAAAACGGCTGGCGCAAACCACGCTGACGACAAGGCTCTGGGGCAGAGTCCGCGATCAACT
GGAAGCCGATGCGCCTCAGGATCTTACCCTTGATCAACTGGCGGGCGAGTCGTCGGCCCATATTTTCACG
CTGTCTGATAAGGCGCTGCTGGCGCGCGGTATTCCGGGGCTGTACACCCAGGAGGGATACCATCAGATTG
TTAAAAAAAAACTGCCGCTGCTGCTGACCAGCGCCTTTCAGGACGATCGGTGGATCATGGGTAATGACCA
GGCCGGCCTGATCAACCCGATAATGCTGCGCAATGACGTGCTGGTGCGCTATCTGGATGAATACGCCGGT
TACTGGGAACGTCTGCTTAACGGGGTCACGCTTCTGCCCGTCGACGCCGCGCAAAGCGCGGGTATGGCGC
CCAACATTTTTATGCTGCGCACGCTGGCCGCGGCTAACTCTCCGCTGGTGAGCCTGGTGCGCGAGGCGGT
AAAGCAAACCACGCTGACGGCGAAAGGGCCGGATATCGCCGAAACGCTTAATCTCACGAACCGCAGCGCG
CTGTTAAGTAACGCCAAAAGAGTGAATGACCAGCTGGCTTTTCAGGAGCGTCGATTGCTACAGGAGCGGG
TCGATAACCGCTTTGCGGCCCTGCGGGAGTTTTATAGCGGCAGCCCGCAGCCGGATGCCAAAACAGGGAG
CGTGAGCGTGATGCCAGGCTCGGCGTTTAACCGGGTCATAGGCGAGCTTAACGATCAATACACGCTGTTC
GTGATGTATGACAACGCGCTGCAAGCCGGCGAGCCGCCTGCGCTTTCCGAGGCGGCCAGACGGCTCGCCG
TGGAATCGGACACCTGGCCTGCGCCGCTTAAAAATATTATCGCCCCGCTGCTTAACCATTCGTTTCAGAA
AGTGGAAGGAGAGACGTTGACGCAACAGCAAGGCGCGATCGCGGCCGGGCCTGGTGAGCTGTGTCGTCGC
GGCATTGAAGGGCGCTACCCGCTAAGCGACAGCGACCAGGAGATCAGCCTCAATCAGTTCGAGCGTTTTT
TTGGCGCAGGCGGCGCGCTGGACGCTTACTTTCAGGCGCACCTTGCCGACAGCGTGGATACGACGGCGAG
CCCGTGGCATTACAAAGGTCGCGCGCAGGGTGAAGGGCTTGGCTTATTTGAGCAGGGCACCGCGCTTCGC
AGCGCGTTATTCCAGGGAGAAAATGGCAGAAAAGTCGCGCTCGATCTCTCCGTGGCCGTGGTCTACATGG
ACCCTTCCATCACGCGGCTACAGATGCAGTTCGATGATGTGGCCGCGGAATACTCTCATGGACCGGTCAC
GCCGCTGTTCTTCCACTGGCCGGGCGGGCAGTCGGCGAACCCGATACGTCTGTCCGCCTGGCCCGCGCAA
AAATCGGCAACTTCTGAGCTTTCGCTGGAAGGCCCCTGGTCGCTGCTGCATTGGGTGGATACCGCAAGCC
AGGTGCGACAGACGCCTGACGGGAAAACAATCCTGACCTTTTTACTCAATAAACGGCGTGTCGATTTTGA
GGTGACAGGCCTGAACTGGGCAGGGCGCTTTGTGCCGGATCTACTGAAAAGTTTTACCTGCCCGGCCGCG
GCATAA
 Primer design