SecReT6
Protein ID: 260597745
SecReT6 ID364
T6SS typei2
Gene symbol-
Locus tagCTU_19530
StrainCronobacter turicensis z3032
Repliconchromosome [GenBank: NC_013282] [Browse all T6SS(s) in this replicon]
Location [Strand]2050474..2053785 [+]
Producthypothetical protein
NoteTssM
UniProt IDC9Y3I1
KEGG IDctu:CTU_19530
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 6.50E-74, Aligned region: 392..705
DUF1215 [PF06744], Evalue: 2.90E-35, Aligned region: 826..947
Protein Sequence: 1103 a.a.     [Download]
>gi|260597745|ref|YP_003210316.1| unnamed protein product [Cronobacter turicensis z3032]
MYACPQWVARNIGLGPFDGPRILTVCSVLAFFMLLMGWLIDKAFEYAGKSGLYLEWGRNKTQASGNDEEI
LRGPEDKSGAVFNETPVIEHLRLRYGRFWQHNVRILLVIGKADDTEKAAPGLCSVCWQEGDGNVLIYGGD
GQSPQDEALLHALKRLRARRPLDGIVHVLDSQKMPTDIERDAFVRCRQQAAQWLGWQAPVWLWLTDNARW
SQETREDMATGILFGPDATTDDAMNVLDALTPRLRRAGIAQMLAEPRHDALLHLASRLQGELKSQLNVLI
EGLMRGPAAYRLRGVMFSPAAAHHPVIPHTRLNTPNWQAVAEDCVQVLPQKMGLDGVRILSLFLLAFAVC
WGAGTLLSLGINRTDIYLAQETSRLAADSTQPLSERLKHQMGLQQTMARLQHREATGAPWYTRFGLNQDH
DMLAALWPLYGRNNTQLMRDAAAAQLQQQLEAFVRLPPLSRARVEGTQRAYDVLKGYLMLAQPDNADASW
LARTLVNIWPKRQGVPDGLWRELSPKLVAFYAQNLPAHPEWKIKPDVELISTVRQILLKQIGQRNAETGL
YQAMLKRIASNWPDLQLADMTGDTDASTLFTTDEVVPGMFTRQAWEEQVQGAIDEVVKSRNDAIDWVLTD
KAHQPDADISPEALKARLTERYFTDFGNAWLNMLNSIQWIEADSLSDSIAQLNLLADVRQSPLVALMNTL
NYQGKTGQQSEALADSLVDSAKKLMGSKKRAKQFLKQAQGPEGPLESVFGPLNGLMEGKDGAGASGNLSF
QSWLSRVTQVRLKLQQVTSAPDPQAMAQKLAQTVFEGKAIDLTDTRDYGSLVAASLGQEWSGFGQALFVQ
PLDLAWRQVLAPAANGLNDRWKTTIVEQWNNAFAGRYPFKSTGSDASLPILAQFLRADSGRIATFLKNNL
GGILHQEGNRWVVDPSASQGMTVNPAFLTAINQLAAIADTVFAQGDASARFELMARPSRDVARVQLTLDG
QKLDYFNQMESWRSFVWPGETWYPGVDLSWRTVTSGMQLYSNQSGKWGFIRLLSKAQITPIDSSRIQLVW
LTPDGSPLKFIMRTEMGDGPLALLKLQDFHLPETIFNTEELTPVENALEQGAE
 
Nucleotide Sequence: 3312 bp     [Download]
>gi|325295716|ref|NC_013282.2|:2050474-2053785 Cronobacter turicensis z3032 chromosome, complete genome
CTGTACGCCTGTCCGCAGTGGGTGGCGAGAAATATCGGGCTCGGGCCCTTTGATGGCCCAAGGATCCTGA
CGGTCTGCTCAGTGCTGGCTTTTTTCATGCTTCTTATGGGGTGGTTGATAGATAAAGCCTTTGAATATGC
GGGTAAATCGGGGCTCTATCTGGAGTGGGGAAGGAATAAAACACAGGCTTCCGGGAATGATGAAGAAATA
CTACGCGGCCCGGAAGATAAAAGCGGAGCCGTGTTCAATGAAACGCCCGTTATAGAGCATCTTCGCCTGC
GCTATGGTCGATTCTGGCAGCATAACGTCCGCATCTTGCTGGTGATTGGCAAGGCGGACGATACGGAAAA
AGCGGCGCCGGGGCTTTGCAGCGTATGCTGGCAGGAGGGCGATGGCAATGTGCTGATTTACGGTGGCGAC
GGGCAATCGCCACAGGATGAGGCTCTACTTCATGCCCTGAAACGTTTGCGCGCACGCCGTCCGCTGGATG
GCATTGTTCATGTGCTCGACAGCCAAAAAATGCCAACTGACATAGAGCGTGATGCTTTTGTCCGCTGTCG
TCAGCAAGCCGCGCAATGGCTGGGCTGGCAGGCGCCGGTCTGGTTATGGCTAACGGATAATGCGCGCTGG
TCACAGGAGACGCGCGAAGATATGGCAACGGGAATACTCTTTGGGCCGGATGCCACGACAGACGACGCGA
TGAACGTTCTCGATGCGCTTACGCCTCGCCTGCGTCGGGCAGGTATCGCGCAGATGCTGGCGGAGCCGCG
ACATGACGCCTTACTGCATCTGGCTTCCCGATTACAGGGGGAGCTGAAATCACAGCTCAACGTATTGATC
GAAGGCTTAATGCGCGGGCCTGCGGCTTACCGGTTACGTGGCGTAATGTTCAGCCCGGCAGCGGCACACC
ATCCCGTTATTCCTCATACTCGCCTGAATACGCCTAACTGGCAGGCGGTAGCGGAGGACTGCGTGCAGGT
ACTTCCCCAAAAAATGGGTCTTGACGGGGTCAGGATACTATCACTTTTTCTGCTGGCTTTTGCGGTTTGC
TGGGGAGCGGGGACGCTGCTGTCGCTCGGCATTAACCGTACCGATATTTATCTGGCGCAGGAGACAAGCC
GCCTCGCTGCGGATAGCACGCAGCCGCTTTCAGAACGCCTGAAACACCAGATGGGGCTCCAGCAGACTAT
GGCGCGTTTGCAACACAGGGAAGCAACCGGCGCCCCCTGGTATACCCGCTTTGGGCTGAATCAGGATCAT
GACATGCTCGCGGCGCTGTGGCCGCTGTATGGCAGGAATAATACCCAGTTGATGCGTGACGCCGCCGCCG
CGCAACTCCAGCAGCAACTGGAAGCGTTTGTTCGACTTCCGCCGCTCAGCAGAGCCAGAGTTGAAGGGAC
GCAACGGGCCTATGATGTACTGAAAGGGTATCTGATGCTGGCGCAACCGGATAACGCAGATGCAAGCTGG
CTTGCCAGAACACTTGTGAATATCTGGCCGAAGCGTCAGGGCGTACCGGATGGTCTCTGGCGCGAGCTGT
CGCCAAAATTAGTGGCGTTTTATGCGCAAAACCTTCCGGCGCATCCGGAATGGAAAATCAAACCTGATGT
TGAACTTATCAGCACCGTTCGCCAGATCCTGCTTAAACAGATAGGCCAGCGTAACGCAGAAACCGGGCTC
TATCAGGCGATGCTGAAGCGCATTGCCAGTAACTGGCCAGACTTACAGCTGGCGGATATGACGGGCGACA
CCGATGCGTCCACGCTGTTTACCACAGATGAGGTAGTGCCGGGCATGTTCACCCGTCAGGCCTGGGAAGA
GCAGGTCCAGGGCGCCATTGATGAGGTGGTGAAATCCCGTAACGATGCCATTGACTGGGTACTCACCGAT
AAAGCCCACCAGCCCGATGCCGACATTTCGCCAGAGGCGCTCAAAGCACGCCTGACAGAACGCTACTTTA
CCGATTTCGGCAATGCCTGGCTCAATATGCTCAACAGCATCCAGTGGATTGAAGCGGATTCGTTATCTGA
TTCCATCGCGCAATTGAATCTGCTGGCAGATGTGCGTCAGTCTCCGCTAGTCGCGTTGATGAATACCCTG
AACTATCAGGGGAAAACGGGTCAGCAGAGTGAGGCGCTGGCGGATTCACTGGTGGATTCTGCTAAAAAAT
TGATGGGGAGTAAAAAAAGGGCAAAGCAATTCCTTAAACAGGCGCAGGGGCCGGAAGGACCGCTCGAGAG
CGTGTTCGGCCCGTTAAACGGATTAATGGAAGGCAAAGACGGTGCCGGGGCGAGCGGCAATCTGAGCTTT
CAGTCCTGGCTTTCCCGCGTTACGCAGGTACGCCTTAAGCTTCAGCAGGTGACCAGCGCACCTGATCCGC
AAGCCATGGCGCAGAAGCTGGCGCAAACGGTCTTTGAGGGCAAAGCCATCGATCTGACTGATACCCGCGA
TTACGGCAGCCTTGTCGCGGCCAGTCTTGGCCAGGAGTGGAGCGGTTTTGGGCAGGCCTTGTTTGTCCAG
CCGCTGGATCTGGCCTGGCGTCAGGTTCTGGCCCCGGCAGCCAATGGCCTGAATGATCGCTGGAAGACCA
CCATTGTTGAGCAATGGAACAACGCATTTGCCGGGCGTTATCCGTTTAAATCTACCGGTAGCGATGCCTC
GTTGCCGATACTGGCGCAATTCCTGCGCGCTGACTCCGGGCGTATCGCCACCTTCCTGAAAAATAATCTC
GGGGGAATTTTACATCAGGAGGGTAACCGCTGGGTGGTGGACCCCTCTGCCAGCCAGGGAATGACGGTGA
ATCCGGCGTTTCTTACAGCAATCAATCAACTGGCGGCTATTGCCGATACGGTTTTCGCGCAGGGAGACGC
CAGTGCGCGTTTTGAGCTGATGGCGCGTCCCTCGCGCGATGTCGCCCGCGTGCAGTTGACGCTTGACGGA
CAAAAGCTCGATTACTTCAACCAGATGGAGAGCTGGCGAAGCTTTGTCTGGCCGGGAGAGACCTGGTATC
CGGGCGTTGATCTTAGCTGGCGTACCGTAACCAGCGGTATGCAGCTTTACAGCAACCAGTCCGGGAAGTG
GGGATTTATTCGTCTGCTGAGCAAGGCGCAGATTACGCCAATTGACAGCAGCCGGATTCAGCTGGTGTGG
CTTACGCCAGACGGCAGCCCACTGAAATTTATCATGCGAACCGAAATGGGCGACGGGCCGCTCGCACTAC
TGAAACTGCAGGATTTTCATCTGCCTGAAACGATTTTCAACACGGAAGAATTAACGCCTGTCGAGAATGC
ATTGGAGCAAGGGGCGGAATAA
 Primer design