SecReT6
Protein ID: 260842447
SecReT6 ID365
T6SS typei1
Gene symbol-
Locus tagECO103_0215
StrainEscherichia coli O103:H2 str. 12009
Repliconchromosome [GenBank: NC_013353] [Browse all T6SS(s) in this replicon]
Location [Strand]242311..245835 [-]
ProductIcmF-like protein
NoteTssM
UniProt IDC8U1T3
KEGG IDeoh:ECO103_0215
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.80E-84, Aligned region: 323..364
IcmF-related [PF06761], Evalue: 1.80E-84, Aligned region: 505..818
ImcF-related_N [PF14331], Evalue: 5.70E-62, Aligned region: 87..120
ImcF-related_N [PF14331], Evalue: 5.70E-62, Aligned region: 205..455
DUF1215 [PF06744], Evalue: 8.00E-34, Aligned region: 304..322
DUF1215 [PF06744], Evalue: 8.00E-34, Aligned region: 914..1033
AAA_22 [PF13401], Evalue: 0.00058, Aligned region: 140..273
AAA_22 [PF13401], Evalue: 0.00058, Aligned region: 856..887
Protein Sequence: 1174 a.a.     [Download]
>gi|260842447|ref|YP_003220225.1| IcmF-like protein [Escherichia coli O103:H2 str. 12009]
MFRLPTPRLLSGLKSALRPAMPRFKVSAFWLLILAWIFLLVWIWWKGPTWTLYEEQWLKPLANRWLATAA
WGIIALMWLTVRVMKRLQQLEKQQKQQREEAIDPLSVELNAQQRYLDRWLLRLQRHLDNRRFLWQLPWYM
VIGPAGSGKTTLLREGFPSDIIYAPEGSRGAEQRLYLTPHVGKQAVIFDIDGTLCAPADADILHRRLWEH
TLGWLKEKRARQPLNGIILTLDLPDLLTADKRRREYLLQTLRSRLQDIRQHLHCQLPVYVVLTRLDLLQG
FAALFQSLNRQDRDAILGVTFTRRAHENDDWRTELNAFWQTWVDRMNLALPDLMVAQTHTRASLFSFSRQ
MQGSREPLVSLLEGLLDGENMNVMLRGVYLTSSLQRGQMDDIFTQSAARQYRLGNNPLASWPLVDTAPYF
TRSLFPQALLAEPNLATESRDWLMRSRRRLTVFSATGGVAALLLITGWHHYYNGNYQSGITVLKQAKAFM
DVPPPQGKDDYGNLQLPLLNPVRDATLAYGDWGDRSRLADMGLYQGRRIGPYVEQTYLQLLEQRYLPSLF
NGLVKAMNAAPPESEEKLAVLRVMRMLEDKSGRNNEVVKQYMAKRWSEKFHGQRDIQAQLMSHLDYALAH
TDWHAERQAGDGDAISRWMPYDKPVVSAQKELSKLPVYQRVYQSLKTRALGVLPADLNLRDQVGPTFDQV
FTSADDNKLVVPQFLTRYGLQSYFVKQRDELVELTAMDSWVLNLTRSVKYSDADRAEIQRQLTEQYISDY
TATWRAGMDNLNIRNFESIGQLTGALEQVISGDQPLQRALTVLRDNTQPGVFSEKLSAKERDEALAEPDY
QLLTRLGHEFAPENSTLAVQKDKESTMQAVYQQLTELHRYLLAIQNAPVPGKSALKAVQLRLDQNSSDPI
FATRQMAKTLPAPLNRWVGRLADQAWHVVMVEAVHYMEVDWRDSVVKPFNEQLANNYPFNPRSAQDASLD
AFERFFKPDGILDTFYQQNLKLFIDNDLSLEDGDNSVIIREDIIAQLKTAQKIRDIFFSKQNGLGTSFAV
ETVSLSGNKRRSVLNLDGQLVDYSQGRNYTAHLVWPNNMREGNESKLTLIGTSGNAPRSISFSGPWAQFR
LFGAGQLTGVQDGNFTVRFSVDAGAMTYRVHTDTEDNPFSGGLFSQFGLSDTLY
 
Nucleotide Sequence: 3525 bp     [Download]
>gi|260842239|ref|NC_013353.1|:c245835-242311 Escherichia coli O103:H2 str. 12009, complete genome
GTGTTCAGATTACCAACACCCCGACTACTCAGCGGACTCAAATCAGCCCTGCGACCGGCGATGCCCCGGT
TTAAAGTCTCTGCTTTCTGGCTGCTGATACTGGCGTGGATTTTTCTGCTGGTGTGGATCTGGTGGAAAGG
CCCGACGTGGACGCTGTATGAAGAACAGTGGCTCAAACCACTGGCGAACCGCTGGCTGGCAACGGCGGCG
TGGGGGATTATTGCCCTGATGTGGCTTACCGTCCGGGTGATGAAGCGCCTGCAACAGCTTGAAAAACAGC
AAAAACAACAGCGCGAGGAAGCCATTGATCCGCTCAGTGTGGAACTGAACGCCCAGCAGCGTTACCTCGA
CCGCTGGCTGCTGCGCCTGCAACGCCATCTCGACAACCGCCGTTTCCTGTGGCAATTGCCGTGGTATATG
GTCATCGGCCCGGCGGGCAGTGGCAAAACGACACTGCTGCGCGAGGGGTTTCCGTCAGACATTATTTATG
CCCCGGAGGGCTCGCGCGGCGCAGAACAACGCCTGTACCTTACGCCCCATGTCGGTAAACAGGCGGTGAT
CTTTGATATCGACGGCACACTCTGCGCTCCCGCTGATGCGGATATCCTGCATCGCCGTCTGTGGGAACAT
ACCCTCGGCTGGCTGAAGGAAAAGCGCGCGCGCCAGCCGCTGAACGGGATTATTCTGACACTCGATTTAC
CCGATCTGCTGACCGCAGACAAGCGCCGCCGTGAGTATCTGCTACAGACGCTGCGCAGCCGCTTGCAGGA
TATACGCCAGCATCTTCACTGCCAGCTACCGGTTTACGTGGTACTGACCCGGCTTGATTTATTGCAGGGT
TTTGCCGCCCTGTTCCAGTCCCTGAACAGACAGGATCGTGATGCGATTCTGGGTGTCACGTTCACCCGCC
GTGCCCATGAAAATGATGACTGGCGAACAGAGTTGAATGCTTTCTGGCAGACATGGGTGGATCGAATGAA
TCTGGCGTTGCCGGATCTGATGGTCGCTCAGACTCACACCCGCGCGTCTTTATTCAGTTTTTCCCGCCAG
ATGCAGGGAAGCCGTGAACCCCTGGTGTCACTGCTTGAAGGTCTGCTTGACGGCGAAAATATGAACGTGA
TGCTGCGTGGTGTCTATCTCACCTCGTCACTGCAACGCGGCCAGATGGATGACATCTTTACCCAGTCCGC
CGCCCGCCAGTACCGGCTGGGCAATAACCCACTGGCGTCCTGGCCCCTGGTGGACACCGCGCCTTATTTC
ACCCGCAGCCTGTTCCCGCAGGCATTACTCGCAGAGCCTAATCTGGCAACGGAGAGCCGTGACTGGCTGA
TGCGTTCCCGTCGCCGCCTGACGGTTTTCTCTGCCACAGGCGGCGTGGCGGCACTGCTGCTCATCACCGG
CTGGCATCACTATTACAACGGTAACTATCAGTCCGGCATCACCGTGCTTAAGCAGGCCAAAGCCTTTATG
GACGTGCCGCCTCCGCAGGGGAAAGACGACTACGGCAACCTGCAACTGCCGCTGCTGAACCCGGTACGCG
ATGCCACACTGGCCTATGGCGACTGGGGCGACCGCAGCCGTCTGGCCGATATGGGACTGTACCAGGGACG
ACGTATCGGGCCTTATGTGGAACAGACCTATCTGCAACTACTAGAGCAGCGTTACCTGCCCTCGCTGTTT
AACGGGCTGGTCAAAGCGATGAACGCCGCGCCGCCGGAGAGTGAGGAAAAACTCGCCGTGCTGCGCGTGA
TGCGAATGCTGGAGGACAAAAGCGGACGCAATAATGAGGTAGTGAAGCAGTATATGGCAAAACGCTGGAG
CGAAAAGTTCCACGGCCAGCGTGATATCCAGGCACAACTGATGTCCCATCTTGACTACGCGCTGGCTCAT
ACTGACTGGCATGCAGAGCGTCAGGCGGGCGACGGTGACGCCATCAGCCGCTGGATGCCATATGACAAGC
CCGTGGTATCAGCACAGAAAGAACTGAGCAAACTGCCTGTCTACCAGCGGGTTTACCAGAGCCTGAAAAC
GCGGGCGCTGGGCGTTCTACCTGCTGACCTCAATCTGCGTGACCAGGTAGGGCCAACCTTTGACCAGGTC
TTTACATCTGCCGATGACAACAAACTGGTTGTTCCACAGTTTCTTACCCGTTACGGCCTGCAAAGCTATT
TTGTAAAACAGCGCGATGAACTGGTTGAACTGACGGCAATGGATTCCTGGGTACTCAACCTCACCCGCAG
TGTGAAATACAGTGACGCCGACCGCGCGGAAATCCAGCGCCAGTTGACCGAGCAGTATATCAGCGACTAC
ACCGCTACCTGGCGAGCCGGGATGGACAATCTGAATATCCGCAATTTTGAGTCCATTGGACAACTGACCG
GGGCGCTGGAGCAGGTTATCAGCGGCGACCAGCCTTTGCAGCGGGCGCTGACTGTGTTGCGTGACAACAC
ACAGCCAGGCGTCTTTTCTGAAAAACTTTCTGCCAAAGAACGGGATGAGGCTCTGGCAGAACCGGACTAC
CAGTTGCTCACCCGCCTCGGGCATGAATTTGCCCCGGAAAACAGTACTCTGGCAGTACAGAAAGACAAAG
AAAGCACGATGCAGGCCGTGTATCAGCAACTCACCGAGTTGCACCGCTATCTGCTGGCAATTCAGAACGC
GCCTGTACCAGGGAAATCGGCGCTGAAAGCCGTGCAGTTGCGGCTTGATCAGAACAGCAGCGATCCGATA
TTCGCCACCCGCCAGATGGCAAAGACACTGCCTGCTCCGCTCAACCGCTGGGTTGGCAGACTGGCTGACC
AGGCCTGGCATGTGGTGATGGTGGAGGCCGTTCACTATATGGAAGTGGACTGGCGCGACAGCGTGGTGAA
ACCGTTTAACGAGCAACTGGCAAATAACTATCCGTTTAATCCGCGTTCTGCACAGGATGCCTCACTGGAT
GCCTTCGAACGCTTCTTTAAACCGGATGGCATACTGGATACCTTCTACCAGCAGAACCTGAAGCTGTTTA
TCGACAATGACCTGAGTCTGGAGGATGGCGATAACAGCGTCATTATTCGCGAAGATATTATTGCGCAACT
GAAAACCGCGCAGAAAATCCGTGACATCTTCTTCAGTAAACAGAACGGTCTGGGAACATCCTTTGCCGTG
GAAACGGTATCGCTCTCCGGCAACAAACGCCGCAGTGTACTGAACCTTGACGGCCAGTTAGTCGATTACA
GCCAGGGGCGCAACTATACCGCCCATCTGGTCTGGCCTAACAATATGCGCGAAGGCAACGAAAGCAAACT
GACGCTCATCGGCACCAGCGGCAACGCACCGCGCAGTATCAGCTTCAGCGGGCCGTGGGCGCAGTTCCGC
CTTTTCGGGGCCGGACAACTGACCGGAGTTCAGGATGGCAACTTTACCGTGCGCTTTAGCGTGGACGCTG
GCGCGATGACCTACCGTGTGCATACCGACACTGAGGATAACCCATTCAGCGGTGGGTTATTCAGCCAGTT
TGGTCTGTCAGACACACTGTACTGA
 Primer design