SecReT6
Protein ID: 260845460
SecReT6 ID366
T6SS typei2
Gene symbol-
Locus tagECO103_3357
StrainEscherichia coli O103:H2 str. 12009
Repliconchromosome [GenBank: NC_013353] [Browse all T6SS(s) in this replicon]
Location [Strand]3415188..3415697 [+]
Producthypothetical protein
NoteTssB
UniProt IDC8UAE6
KEGG IDeoh:ECO103_3357
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.30E-52, Aligned region: 6..158
Protein Sequence: 169 a.a.     [Download]
>gi|260845460|ref|YP_003223238.1| hypothetical protein ECO103_3357 [Escherichia coli O103:H2 str. 12009]
MADSFQNEVPAARVNIKLDLHTGNAKKKVELPLKLLAVGDYSNGKEQRPLSERDKIDINKNNFNSVMAEF
SPAVNLTVEDTLSGSGNEQNIALEFKSLKDFEPEQVAKNIPQLRVLLAMRNLLRDLKSNLLDNATFRREL
ENILKDPTLSSELRDELAKLRRRRTFNPK
 
Nucleotide Sequence: 510 bp     [Download]
>gi|260842239|ref|NC_013353.1|:3415188-3415697 Escherichia coli O103:H2 str. 12009, complete genome
ATGGCCGACAGTTTCCAGAATGAAGTTCCCGCCGCTCGTGTAAATATCAAGCTTGACCTGCATACAGGCA
ATGCTAAAAAGAAAGTTGAACTCCCCCTCAAGCTTCTTGCTGTTGGCGATTACAGTAACGGAAAAGAGCA
ACGTCCGCTGTCCGAACGGGACAAGATTGATATCAATAAAAACAACTTCAACAGTGTCATGGCTGAGTTT
TCGCCTGCGGTTAATTTAACAGTAGAAGACACACTAAGCGGAAGCGGTAATGAGCAAAATATCGCGCTTG
AATTTAAAAGCCTGAAAGATTTTGAACCCGAACAGGTAGCAAAAAATATCCCACAGCTTCGTGTATTACT
CGCTATGCGCAATTTATTACGTGACCTGAAATCCAATCTGCTGGATAACGCAACGTTTCGCCGTGAACTG
GAAAATATTCTGAAAGACCCAACGCTCAGTTCAGAACTGCGTGATGAACTGGCGAAATTGCGCCGCAGGA
GAACGTTTAACCCGAAGTGA
 Primer design