SecReT6
Protein ID: 260845462
SecReT6 ID366
T6SS typei2
Gene symbol-
Locus tagECO103_3359
StrainEscherichia coli O103:H2 str. 12009
Repliconchromosome [GenBank: NC_013353] [Browse all T6SS(s) in this replicon]
Location [Strand]3417302..3418639 [+]
Producthypothetical protein
NoteTssK
UniProt IDC8UAE8
KEGG IDeoh:ECO103_3359
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.20E-131, Aligned region: 18..442
Protein Sequence: 445 a.a.     [Download]
>gi|260845462|ref|YP_003223240.1| hypothetical protein ECO103_3359 [Escherichia coli O103:H2 str. 12009]
MKIHRPLWAEGTFLSSQQFQQQARWEAFSNDSIAQLCIRHPWGIANVLFDRDALMSGKLKTQAVRLRFAD
GTLIDSDVSDVLPLACDLHALTNDSAVVLLALPLAHGNGGNLGQGEQTERPLRYRQEWQKVQDIYGSDSE
DMAVERHALSLRFAHDNNQDYITCPLARLVRDVQGNWTQDEGYIPPLLAFNAHDGLVQRLDTLLLQLRAK
CQRLMAMRRESNQRMADFAVADVSLFWLLNALNSAEPVLSDFLRYPAVHPELVWRELARLAGALLTFSLE
HNVSAVPPYVHESPSTVFPPLFSLLSELLEASLPSRVIALDLGSLPGNRWKADLHDPRLREEADFYLSVR
SSLPAHQVLHQLPLVCKIGAPDDVTLLINVALNGVPLVPLTSVPAALPLRLENQYFALDMHSDAAKSMLE
SGCCMIYAPGTMGDLKPELFAVLRT
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|260842239|ref|NC_013353.1|:3417302-3418639 Escherichia coli O103:H2 str. 12009, complete genome
ATGAAAATTCATCGACCACTGTGGGCTGAGGGGACATTCCTGTCCTCTCAGCAGTTTCAGCAGCAGGCCC
GCTGGGAAGCGTTCAGCAATGACAGCATTGCGCAACTTTGTATTCGTCATCCGTGGGGGATCGCGAATGT
GCTCTTTGACCGCGATGCCCTGATGTCCGGAAAGCTGAAAACGCAGGCAGTACGCCTGCGTTTTGCTGAT
GGCACGCTGATCGATTCTGACGTGAGCGATGTTCTGCCTCTCGCCTGCGATCTGCACGCGCTGACGAACG
ACAGCGCGGTTGTTCTGCTGGCGCTGCCGCTTGCCCATGGTAACGGCGGTAATCTCGGTCAGGGTGAGCA
GACTGAAAGACCGCTACGCTATCGTCAGGAATGGCAAAAGGTACAGGATATCTACGGCAGTGACAGTGAA
GATATGGCCGTTGAGCGTCATGCGCTGTCCCTGCGCTTTGCTCATGATAACAATCAGGATTACATCACCT
GCCCACTGGCGCGTCTGGTGCGGGATGTTCAGGGCAACTGGACACAGGATGAGGGCTATATTCCGCCGTT
ACTGGCGTTTAATGCTCATGACGGGTTGGTACAGCGTCTGGACACGCTGCTGTTGCAGCTACGGGCCAAA
TGTCAGCGCCTGATGGCGATGCGTCGGGAAAGCAACCAGCGTATGGCGGACTTCGCCGTCGCCGATGTCT
CCCTGTTCTGGTTGCTTAACGCGCTGAACTCCGCCGAGCCGGTGCTGAGTGATTTCCTGCGCTACCCGGC
GGTTCATCCCGAACTGGTCTGGCGGGAGCTGGCGAGGCTTGCCGGAGCGCTGCTGACGTTTTCCCTTGAA
CATAACGTCAGCGCCGTTCCGCCCTATGTCCACGAATCGCCGTCCACTGTCTTTCCGCCACTGTTCTCCC
TGCTCAGCGAACTGCTGGAAGCAAGCCTGCCGTCACGGGTGATCGCGCTGGATCTGGGATCCCTGCCGGG
CAACCGCTGGAAAGCCGACCTGCACGATCCGCGCCTGCGGGAAGAGGCCGATTTTTACCTGTCCGTTCGT
TCCTCACTGCCTGCGCATCAGGTACTGCACCAGCTACCGCTGGTCTGCAAAATCGGTGCGCCTGATGACG
TCACGCTGCTTATCAACGTGGCGCTGAATGGTGTTCCACTGGTGCCACTGACCTCAGTTCCGGCAGCGCT
GCCACTGCGCCTGGAGAATCAGTATTTTGCGCTGGATATGCACAGTGACGCGGCTAAATCGATGCTGGAG
TCCGGGTGCTGCATGATTTATGCGCCAGGAACCATGGGCGACCTGAAACCTGAACTGTTTGCGGTGCTGC
GCACATGA
 Primer design