SecReT6
Protein ID: 260845463
SecReT6 ID366
T6SS typei2
Gene symbol-
Locus tagECO103_3360
StrainEscherichia coli O103:H2 str. 12009
Repliconchromosome [GenBank: NC_013353] [Browse all T6SS(s) in this replicon]
Location [Strand]3418636..3419301 [+]
Producthypothetical protein
NoteTssL
UniProt IDC8UAE9
KEGG IDeoh:ECO103_3360
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 8.50E-48, Aligned region: 8..208
Protein Sequence: 221 a.a.     [Download]
>gi|260845463|ref|YP_003223241.1| hypothetical protein ECO103_3360 [Escherichia coli O103:H2 str. 12009]
MKKETDINIDALLRDTFLTVVELRQGTTVRHGMELYRHCQRQVEGVRERLKDAGFSRENVEHITYAQCAL
LDETVLSRSGMDDGQAIWMKDPLQAHFFNTLQAGELLYERMKQVLQEPAPAQAVLTCFHRVLLLGFRGRY
QDPVAPERDQLISTLNGLVAPFGVLPETAVLNVPLSPRQHPLLHSPFFWLVTLTLLLAGVWWGLHHWLNV
LVDELLPQSLR
 
Nucleotide Sequence: 666 bp     [Download]
>gi|260842239|ref|NC_013353.1|:3418636-3419301 Escherichia coli O103:H2 str. 12009, complete genome
ATGAAAAAAGAGACGGATATCAATATCGACGCGCTGCTGCGCGACACGTTTCTGACGGTGGTGGAACTGC
GTCAGGGAACCACCGTGCGTCACGGTATGGAGCTGTATCGCCACTGCCAGCGGCAGGTGGAGGGGGTCCG
CGAACGCCTGAAAGATGCCGGGTTCAGCCGGGAGAACGTGGAGCACATTACTTACGCACAGTGCGCCCTG
CTGGACGAAACAGTCCTGAGTCGCAGCGGCATGGACGACGGTCAGGCCATCTGGATGAAGGATCCACTCC
AGGCGCATTTCTTCAACACCCTGCAGGCAGGCGAGCTGCTGTACGAGCGGATGAAGCAGGTGTTGCAGGA
GCCCGCGCCTGCACAGGCAGTGCTGACCTGCTTTCACCGTGTCCTGCTGCTGGGATTTCGCGGGCGTTAT
CAGGATCCGGTGGCCCCGGAGCGTGACCAACTTATTTCGACGCTCAACGGGCTGGTCGCGCCATTTGGCG
TGCTGCCGGAAACGGCGGTACTGAACGTGCCGTTATCCCCCCGTCAGCACCCTTTGCTGCATTCGCCGTT
TTTCTGGCTGGTAACGCTGACGCTGCTACTGGCCGGTGTCTGGTGGGGACTGCACCACTGGCTGAACGTG
CTGGTGGATGAATTGCTGCCGCAAAGCCTGCGGTAA
 Primer design