SecReT6
Protein ID: 260845464
SecReT6 ID366
T6SS typei2
Gene symbol-
Locus tagECO103_3361
StrainEscherichia coli O103:H2 str. 12009
Repliconchromosome [GenBank: NC_013353] [Browse all T6SS(s) in this replicon]
Location [Strand]3419314..3420966 [+]
Productouter membrane lipoprotein
NoteTagL
UniProt IDC8UAF0, C8UAF0
KEGG IDeoh:ECO103_3361
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 4.10E-17, Aligned region: 437..533
Protein Sequence: 550 a.a.     [Download]
>gi|260845464|ref|YP_003223242.1| outer membrane lipoprotein [Escherichia coli O103:H2 str. 12009]
MRNTLKQAVVLWGMVLLLVLWSVFISPSGVLIWAGAAAIVLTVAALLIYRRRQAWTEMTGDAGLLSLPPE
TYRQPVVLVCGDMSAHLFTDSPVRQVSEGLYLHVSDEEQLVAQAERLLTLRPAWASQLAVAYTVMPGMYR
DAAVLTGQLRRFAHSMATVRRRAGVNVPWLLWSGLSGSPLPERANSPWFICTGGEIHVATSAETASPAQW
LTQTSTQERSQQLCYLLKAESLMQWLNLNMLAALNGPETKCPPLAMAVGLVPSLPAVDNNLWQLWITART
GLTTDIADTGTDATLPFPDALLRRLPRQSGFTPLRRACVTMLGITTVAGIAALCLSATENRQLLRHIGDD
LHQFYAVPAEEFITKARRLSVLKDDAIMLDGYYREGEPLRLGLGLYPGEQIRQPVLRAIRDWRPPEQKME
VTASLQAQTVRLDSMSLFDVGQARLKDGSTKVLVDALVNIRAKPGWLILVAGYTDATGDEKSNQQLSLRR
AEAVRNWMLQTSDIPATCFAVQGLGESQPAATNDTPQGRAVNRRVEISLVPRSDACQDVK
 
Nucleotide Sequence: 1653 bp     [Download]
>gi|260842239|ref|NC_013353.1|:3419314-3420966 Escherichia coli O103:H2 str. 12009, complete genome
GTGAGGAACACGCTGAAACAGGCCGTCGTGCTGTGGGGAATGGTGTTACTGCTGGTGCTGTGGTCGGTGT
TTATCAGTCCGTCTGGCGTACTGATATGGGCCGGGGCGGCGGCTATCGTTCTGACGGTTGCCGCGTTGCT
GATTTACCGGCGCAGGCAGGCGTGGACGGAGATGACCGGCGATGCCGGGTTGTTATCGCTGCCGCCGGAA
ACGTACCGACAACCGGTAGTGCTGGTCTGTGGCGATATGTCGGCGCATCTGTTCACTGACAGCCCGGTCC
GGCAGGTTTCAGAAGGGCTGTATCTGCATGTTTCTGATGAAGAACAGCTTGTGGCGCAGGCGGAGCGATT
ACTGACCCTTCGCCCGGCGTGGGCATCGCAGCTTGCCGTGGCATATACCGTCATGCCCGGCATGTACCGG
GATGCGGCGGTTCTGACCGGACAACTGCGCCGGTTCGCCCACAGTATGGCGACAGTGCGTCGCCGGGCGG
GCGTAAACGTCCCCTGGCTTCTCTGGAGCGGGCTGTCCGGCTCGCCGTTGCCGGAGAGAGCGAATTCACC
GTGGTTTATCTGTACCGGCGGCGAAATTCATGTAGCGACGTCTGCTGAAACCGCCTCCCCCGCGCAGTGG
CTCACGCAGACCAGCACACAGGAGCGCAGCCAGCAACTCTGTTACCTGCTGAAAGCCGAAAGCCTGATGC
AGTGGCTGAATCTTAATATGCTGGCGGCACTGAACGGCCCGGAAACGAAATGTCCGCCACTGGCGATGGC
CGTGGGGCTGGTCCCCTCGTTGCCTGCGGTGGATAACAACCTGTGGCAGTTGTGGATCACCGCCAGAACC
GGCCTGACGACGGATATCGCGGACACCGGCACAGACGCCACGCTGCCGTTTCCGGATGCCCTGTTACGGC
GGTTGCCGCGTCAGTCGGGCTTTACCCCGCTGCGACGAGCCTGCGTGACCATGCTGGGCATCACCACCGT
GGCGGGTATCGCCGCGCTGTGTCTGTCAGCCACGGAGAATCGCCAGTTATTACGGCATATCGGTGATGAT
CTGCACCAGTTTTATGCCGTTCCGGCGGAGGAATTTATCACCAAAGCCCGTCGTCTGTCGGTGCTGAAAG
ACGATGCGATCATGCTCGATGGGTATTACCGGGAAGGAGAGCCACTGCGTCTCGGTCTGGGGTTATACCC
CGGTGAACAAATCCGCCAGCCGGTATTACGCGCCATTCGTGACTGGCGTCCGCCTGAGCAAAAAATGGAA
GTGACAGCCTCGCTTCAGGCGCAGACCGTGCGTCTTGACAGTATGTCGCTGTTTGACGTCGGACAGGCCC
GCCTGAAAGACGGCTCGACAAAAGTGCTGGTGGACGCACTGGTGAACATCCGGGCAAAACCGGGCTGGCT
GATCCTCGTGGCCGGATATACCGACGCCACCGGCGACGAAAAAAGCAATCAGCAGTTATCGCTGCGACGT
GCCGAAGCGGTGCGCAACTGGATGCTGCAGACCAGCGACATCCCGGCCACCTGTTTTGCCGTACAGGGAC
TGGGCGAGAGCCAGCCTGCGGCGACCAACGATACGCCACAGGGCCGGGCAGTCAACCGGCGCGTCGAAAT
CAGTCTTGTTCCGCGTTCTGACGCCTGTCAGGACGTGAAATAA
 Primer design