SecReT6
Protein ID: 260845466
SecReT6 ID366
T6SS typei2
Gene symbol-
Locus tagECO103_3363
StrainEscherichia coli O103:H2 str. 12009
Repliconchromosome [GenBank: NC_013353] [Browse all T6SS(s) in this replicon]
Location [Strand]3421706..3424360 [+]
ProductATP-dependent Clp proteinase ATP-binding chain
NoteTssH
UniProt IDC8UAF2
KEGG IDeoh:ECO103_3363
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.70E-40, Aligned region: 238..257
AAA_2 [PF07724], Evalue: 1.70E-40, Aligned region: 612..777
AAA [PF00004], Evalue: 1.30E-19, Aligned region: 22..57
AAA [PF00004], Evalue: 1.30E-19, Aligned region: 240..355
AAA [PF00004], Evalue: 1.30E-19, Aligned region: 617..740
AAA [PF00004], Evalue: 1.30E-19, Aligned region: 766..782
AAA_5 [PF07728], Evalue: 1.60E-14, Aligned region: 240..266
AAA_5 [PF07728], Evalue: 1.60E-14, Aligned region: 616..735
ClpB_D2-small [PF10431], Evalue: 2.10E-14, Aligned region: 395..414
ClpB_D2-small [PF10431], Evalue: 2.10E-14, Aligned region: 783..858
AAA_16 [PF13191], Evalue: 1.50E-13, Aligned region: 217..262
AAA_16 [PF13191], Evalue: 1.50E-13, Aligned region: 288..321
AAA_16 [PF13191], Evalue: 1.50E-13, Aligned region: 489..516
AAA_16 [PF13191], Evalue: 1.50E-13, Aligned region: 599..652
AAA_16 [PF13191], Evalue: 1.50E-13, Aligned region: 681..710
AAA_16 [PF13191], Evalue: 1.50E-13, Aligned region: 756..808
AAA_22 [PF13401], Evalue: 2.70E-09, Aligned region: 239..328
AAA_22 [PF13401], Evalue: 2.70E-09, Aligned region: 361..405
AAA_22 [PF13401], Evalue: 2.70E-09, Aligned region: 483..515
AAA_22 [PF13401], Evalue: 2.70E-09, Aligned region: 613..653
AAA_25 [PF13481], Evalue: 3.80E-08, Aligned region: 240..270
AAA_25 [PF13481], Evalue: 3.80E-08, Aligned region: 297..331
AAA_25 [PF13481], Evalue: 3.80E-08, Aligned region: 368..411
AAA_25 [PF13481], Evalue: 3.80E-08, Aligned region: 612..645
AAA_19 [PF13245], Evalue: 8.90E-08, Aligned region: 237..261
AAA_19 [PF13245], Evalue: 8.90E-08, Aligned region: 612..638
Clp_N [PF02861], Evalue: 3.40E-07, Aligned region: 24..73
Clp_N [PF02861], Evalue: 3.40E-07, Aligned region: 108..124
Arch_ATPase [PF01637], Evalue: 8.40E-07, Aligned region: 218..392
Arch_ATPase [PF01637], Evalue: 8.40E-07, Aligned region: 609..630
Arch_ATPase [PF01637], Evalue: 8.40E-07, Aligned region: 685..698
AAA_17 [PF13207], Evalue: 5.20E-06, Aligned region: 240..345
AAA_17 [PF13207], Evalue: 5.20E-06, Aligned region: 615..651
Zeta_toxin [PF06414], Evalue: 5.80E-06, Aligned region: 233..265
Zeta_toxin [PF06414], Evalue: 5.80E-06, Aligned region: 607..656
AAA_14 [PF13173], Evalue: 7.90E-06, Aligned region: 240..339
AAA_14 [PF13173], Evalue: 7.90E-06, Aligned region: 614..698
NACHT [PF05729], Evalue: 9.20E-06, Aligned region: 110..135
NACHT [PF05729], Evalue: 9.20E-06, Aligned region: 240..340
NACHT [PF05729], Evalue: 9.20E-06, Aligned region: 616..640
Sigma54_activat [PF00158], Evalue: 1.60E-05, Aligned region: 224..254
Sigma54_activat [PF00158], Evalue: 1.60E-05, Aligned region: 615..733
Sigma54_activat [PF00158], Evalue: 1.60E-05, Aligned region: 766..800
IstB_IS21 [PF01695], Evalue: 3.40E-05, Aligned region: 234..279
IstB_IS21 [PF01695], Evalue: 3.40E-05, Aligned region: 501..533
IstB_IS21 [PF01695], Evalue: 3.40E-05, Aligned region: 616..635
AAA_18 [PF13238], Evalue: 0.00037, Aligned region: 240..275
AAA_18 [PF13238], Evalue: 0.00037, Aligned region: 617..641
AAA_29 [PF13555], Evalue: 0.0011, Aligned region: 234..256
AAA_29 [PF13555], Evalue: 0.0011, Aligned region: 612..627
AAA_24 [PF13479], Evalue: 0.0022, Aligned region: 240..255
AAA_24 [PF13479], Evalue: 0.0022, Aligned region: 617..638
RNA_helicase [PF00910], Evalue: 0.0027, Aligned region: 241..262
RNA_helicase [PF00910], Evalue: 0.0027, Aligned region: 617..638
T2SE [PF00437], Evalue: 0.003, Aligned region: 224..258
T2SE [PF00437], Evalue: 0.003, Aligned region: 612..694
DUF2075 [PF09848], Evalue: 0.0037, Aligned region: 242..345
DUF2075 [PF09848], Evalue: 0.0037, Aligned region: 504..535
DUF2075 [PF09848], Evalue: 0.0037, Aligned region: 615..638
ResIII [PF04851], Evalue: 0.0091, Aligned region: 189..261
ResIII [PF04851], Evalue: 0.0091, Aligned region: 311..325
ResIII [PF04851], Evalue: 0.0091, Aligned region: 616..638
Protein Sequence: 884 a.a.     [Download]
>gi|260845466|ref|YP_003223244.1| ATP-dependent Clp proteinase ATP-binding chain [Escherichia coli O103:H2 str. 12009]
MTGNHPAALLRRLNPYCARALDAAASLCQTRAHAEITIEHWLLKLLEQGEGDITVIARRYEWDIDTLWQS
LLAHLDTLPRSVRERPQLSEPLTALIRQAWLIASLEGDDPQIRSQHLLMALTEKPMLPACNDLWVLLSLS
RVQLERLRPLLDAQSDECPARQPQATEPLTSAQPESATTDAPAKTLTGKQDDALLAVLNRFTEDVTEKAR
SGRIDPVFGRDTEIRQMVDILSRRRKNNPILVGEPGVGKTALVEGLALRITEGNVPDSLKTVHIRTLDLG
LLGLLQAGAGVKGEFEQRLKNVIDAVQKSPEPVLLFIDEAHTIIGAGNQAGGADAANLLKPALARGELRT
IAATTWSEYKQYFERDAALERRFQMVKVDEPDDDTASLMLRGLKARYAQHHGVHMLDSAIQTAVRLSRRY
LTGRQLPDKAVDLLDTAGARVRMSLDTLPEPLTQLQARLTALDIEREAIEQDSVFYPETSPERLAELTDL
RDELQAEAGHLEAQYQQEKRLAQQIMALRQEGADSTDLQQQLRTHQGFAPLLALDVDARAVATVVADWTG
IPLSSLLRDEQSDLLSMEQSLENRVVGQSPALCAIAQRLRAAKTGLTPENGPQGVFLLTGPSGTGKTETA
LTLADTLFGGEKSLITINLSEYQEPHTVSQLKGSPPGYVGYGQGGVLTEAVRKRPYSVVLLDEVEKAHRD
VMNLFYQVFDRGFMRDGEGREIDFRNTVILMTANLGSDHIMQLLEEKPDATDADLHELLYPLLREHFQPA
LMARFQTVIYRPLGQEAMRAIVEMKLAQVVRRLRQHYGLETEINDSLYDALTAACLLPDTGARNIDSLLN
QQILPVLSQQLLAQQAAHRKPAQLRLGWDEEDGIVLEFATEEMQ
 
Nucleotide Sequence: 2655 bp     [Download]
>gi|260842239|ref|NC_013353.1|:3421706-3424360 Escherichia coli O103:H2 str. 12009, complete genome
ATGACCGGAAATCACCCCGCCGCGCTGCTGCGTCGCCTTAACCCGTACTGTGCACGGGCGCTGGACGCTG
CCGCCTCACTGTGTCAGACCCGCGCCCATGCGGAGATAACCATTGAACACTGGCTGCTGAAACTGCTGGA
GCAGGGAGAAGGCGATATCACGGTGATTGCCCGCCGCTATGAATGGGATATCGACACGCTCTGGCAGTCT
CTGCTGGCACATCTGGACACCTTACCCCGCTCGGTCCGCGAACGTCCGCAGCTTTCTGAACCCCTGACGG
CGCTTATCAGGCAGGCGTGGCTGATTGCCTCGCTGGAAGGCGACGACCCGCAAATCCGCAGTCAGCACCT
GCTGATGGCGCTGACAGAAAAACCGATGCTGCCCGCCTGTAATGACCTGTGGGTATTGCTGAGCCTGAGC
CGCGTGCAGCTTGAGCGGCTGCGCCCCCTGCTGGATGCGCAGTCGGATGAATGTCCGGCACGTCAGCCAC
AGGCCACCGAACCGCTGACATCCGCGCAACCAGAGTCGGCAACGACGGACGCACCGGCAAAAACGCTGAC
GGGGAAACAGGATGACGCCCTGCTGGCGGTACTTAACCGCTTTACCGAAGACGTGACGGAAAAAGCCCGC
AGCGGGCGAATCGACCCGGTATTCGGGCGCGACACCGAAATTCGCCAGATGGTCGATATCCTCTCCCGTC
GCCGCAAAAACAACCCGATTCTGGTGGGAGAACCGGGCGTGGGCAAAACCGCGCTGGTGGAAGGGCTGGC
GCTGCGTATCACCGAAGGCAACGTGCCGGACAGCCTGAAAACGGTGCATATCCGCACACTGGACCTCGGT
CTGTTAGGTCTGTTACAGGCTGGCGCGGGCGTTAAAGGTGAATTTGAGCAGCGACTGAAAAACGTGATTG
ATGCAGTACAGAAATCACCGGAGCCGGTACTGCTGTTTATTGATGAAGCCCATACCATTATCGGCGCGGG
TAATCAGGCGGGCGGCGCGGATGCGGCGAACCTGCTGAAACCGGCGCTGGCAAGGGGCGAGCTGCGCACC
ATCGCCGCCACAACGTGGAGCGAATACAAACAGTATTTTGAGCGCGACGCCGCGCTGGAACGCCGCTTCC
AGATGGTGAAAGTCGACGAGCCGGATGATGACACCGCCAGCCTGATGCTGCGGGGACTCAAGGCCCGCTA
TGCACAGCACCACGGCGTACATATGCTGGACAGCGCCATTCAGACCGCCGTGCGCCTGTCGCGCCGCTAT
CTGACCGGACGCCAGTTGCCGGACAAGGCGGTTGATTTGCTGGATACCGCCGGGGCAAGAGTCCGCATGA
GCCTCGACACCCTGCCGGAACCGTTGACGCAGCTTCAGGCGCGTCTGACCGCGCTGGATATTGAGCGGGA
AGCGATTGAGCAGGACAGCGTGTTTTATCCCGAAACCAGCCCGGAGCGGCTGGCGGAACTGACCGATTTG
CGTGATGAGCTACAGGCAGAAGCCGGGCATCTGGAAGCGCAGTATCAGCAGGAAAAGCGGCTTGCGCAGC
AGATTATGGCGTTGCGTCAGGAAGGGGCAGACAGCACTGATTTGCAACAGCAACTGCGAACGCATCAGGG
CTTTGCACCGCTGCTGGCGCTGGATGTGGACGCCCGCGCCGTCGCCACTGTGGTGGCGGACTGGACCGGC
ATCCCGCTCTCTTCCCTGCTCAGGGACGAGCAGAGCGACCTGCTCAGTATGGAACAAAGCCTTGAAAACC
GCGTTGTCGGGCAAAGCCCGGCGCTCTGCGCCATCGCACAGCGGCTGCGGGCGGCTAAAACCGGCCTCAC
GCCGGAGAACGGCCCGCAGGGGGTATTCCTGCTGACCGGCCCCAGCGGCACCGGTAAAACCGAAACTGCG
CTCACACTGGCCGACACCCTGTTTGGCGGTGAAAAATCCCTTATCACCATCAACCTCTCCGAATATCAGG
AGCCGCATACCGTCTCCCAGCTTAAGGGGTCTCCTCCGGGCTACGTTGGCTACGGTCAGGGCGGCGTACT
CACCGAAGCCGTTCGCAAACGCCCGTACAGCGTGGTGCTGCTCGACGAAGTGGAAAAGGCGCATCGCGAC
GTGATGAACCTGTTCTATCAGGTATTTGATCGGGGCTTTATGCGCGACGGCGAAGGCCGGGAAATTGACT
TCCGCAACACCGTGATTCTGATGACGGCTAATCTGGGCAGTGACCACATCATGCAGCTGCTGGAGGAAAA
ACCGGACGCCACGGACGCAGACCTGCATGAACTGCTGTACCCCCTGCTGCGCGAGCACTTCCAGCCTGCA
CTGATGGCGCGTTTTCAGACGGTGATTTACCGCCCTCTGGGACAGGAAGCGATGCGCGCCATTGTGGAAA
TGAAACTGGCGCAGGTGGTTCGTCGTCTTCGTCAGCACTATGGGCTGGAAACGGAAATCAACGACAGCCT
GTATGACGCGCTGACCGCCGCCTGCCTGCTGCCGGACACCGGGGCGCGTAATATCGACAGCCTGCTGAAC
CAGCAAATCCTGCCGGTCTTAAGCCAGCAGTTGCTGGCGCAACAGGCCGCGCACCGTAAACCAGCCCAGC
TACGGCTTGGCTGGGATGAGGAAGACGGGATTGTACTGGAGTTCGCTACGGAAGAGATGCAATAA
 Primer design