SecReT6
Protein ID: 260845467
SecReT6 ID366
T6SS typei2
Gene symbol-
Locus tagECO103_3364
StrainEscherichia coli O103:H2 str. 12009
Repliconchromosome [GenBank: NC_013353] [Browse all T6SS(s) in this replicon]
Location [Strand]3424372..3426879 [+]
Producthypothetical protein
NoteTssI
UniProt IDC8UAF3
KEGG IDeoh:ECO103_3364
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.20E-63, Aligned region: 30..347
DUF2345 [PF10106], Evalue: 1.50E-46, Aligned region: 602..743
T6SS_Vgr [PF13296], Evalue: 7.20E-35, Aligned region: 480..584
Phage_base_V [PF04717], Evalue: 3.50E-14, Aligned region: 392..473
Protein Sequence: 835 a.a.     [Download]
>gi|260845467|ref|YP_003223245.1| hypothetical protein ECO103_3364 [Escherichia coli O103:H2 str. 12009]
MGIQNFDHSHHKLKIRGLQSPVDVLTFEGREQLSTPFRYDIQFTSSDKAITPESVLMQDGAFSLTAPPVQ
GMPVQTALRTLHGVITGFKHLSSSQDEARYEVRLEPRMALLARSRQNAIYQNQTVPQIVEKILRERHQMR
GQDFVFNLKSEYPSREQVMQYGEDDLTFISRLLSEVGIWFRFATDARLKIEVVEFYDDQSGYERGLTLPL
RHPSGLFDGETEAVWGLNTAYSVVEKSVTTRDYNYRTATAEMMTEQHDATGGDNTTYGEAYHYADNFLQK
GDKEAAESGAFYARIRHERYLNEQAILQGQSTSSLLMPGLEIRVQGDDAPAVFRKGVLITGVTASAARDR
SYELTFTAIPYSERYGYRPALIPRPVMAGTLPARVTSTVKNDIYAHIDKDGRYRVNLDFDRDTWKPGYES
LWVRQSRPYAGDTYGLHLPLLAGTEVSIAFEEGNPDRPYIAGVKHDSAHTDHVTIQNYKRNVLRTPANNK
IRLDDERGKEHIKVSTEYGGKSQLNLGHLVDAGKQQRGEGFELRTDMWGAVRAKKGIFISADAQDKAQGQ
VREMAPAMAILDGAQSQMQSLSTDAQTTNADPADLSSQIALLQQSVKDLTQAVILLSAPKGVAIASGEHL
QLAASKNVIANAGNNADIGVVKNMFIGVGQALSVFVRKAGIKLFANKGAVSVQAQNDLMELLAQKSIEIT
STEDEIKITAKKKITLNGGGSYIRLDACGIEAGTPGEYNVKAGYYGRKPKAKLTPELMAFPVIKSEDFNQ
SFILLDENTGQPLINWPYELELESGLKMSGITDENGNTELISSDKEEVVNISVFEPDEFLDDDIN
 
Nucleotide Sequence: 2508 bp     [Download]
>gi|260842239|ref|NC_013353.1|:3424372-3426879 Escherichia coli O103:H2 str. 12009, complete genome
ATGGGTATTCAGAATTTCGATCATTCACACCACAAGCTCAAAATTCGTGGCCTGCAAAGTCCGGTGGATG
TGCTGACCTTCGAAGGCCGCGAACAACTGAGTACCCCGTTCCGCTACGACATTCAGTTTACCAGCAGCGA
TAAAGCCATCACGCCGGAGTCGGTGCTGATGCAGGACGGCGCATTCAGCCTGACGGCACCGCCGGTACAG
GGGATGCCGGTACAGACTGCCCTGCGCACCCTGCACGGCGTCATCACCGGCTTTAAACACCTGTCATCGT
CACAGGATGAAGCCCGTTACGAAGTGCGCCTTGAACCCCGAATGGCGCTGCTGGCCCGCAGCCGCCAGAA
CGCCATTTACCAGAACCAGACGGTGCCGCAAATAGTCGAAAAAATCCTGCGCGAGCGGCACCAGATGCGC
GGTCAGGACTTCGTGTTTAACCTCAAAAGCGAATACCCGTCCCGTGAACAGGTGATGCAGTACGGTGAGG
ACGACCTGACGTTTATTTCACGCCTGCTGTCGGAAGTGGGTATCTGGTTCCGCTTTGCCACCGACGCCCG
GCTGAAAATTGAGGTTGTCGAGTTTTACGACGACCAGAGCGGCTATGAGCGCGGACTGACGCTGCCGCTT
CGCCATCCTTCAGGGCTGTTTGATGGTGAAACGGAAGCCGTATGGGGGCTGAACACCGCATACAGCGTGG
TGGAAAAAAGCGTCACCACGCGGGACTACAACTACCGCACCGCCACAGCAGAGATGATGACAGAGCAGCA
TGACGCCACCGGGGGCGATAACACCACCTATGGCGAAGCCTACCACTACGCTGACAACTTCCTGCAAAAA
GGCGACAAGGAGGCAGCGGAAAGCGGCGCGTTTTATGCCCGTATCCGTCACGAACGCTACCTGAATGAAC
AGGCCATTCTGCAGGGCCAGAGCACCAGTTCACTGCTGATGCCGGGGCTGGAAATCAGGGTTCAGGGCGA
CGACGCGCCTGCGGTATTCCGCAAGGGCGTGCTGATTACCGGCGTGACGGCCAGCGCGGCCCGTGACCGC
AGCTATGAACTGACGTTCACGGCGATACCCTACTCAGAACGCTACGGCTATCGCCCGGCGCTTATCCCCC
GCCCCGTAATGGCCGGAACACTCCCGGCGCGGGTCACCAGTACGGTGAAGAACGACATCTACGCCCATAT
CGATAAGGACGGGCGCTACCGGGTCAATCTCGACTTTGACCGTGATACGTGGAAGCCGGGCTACGAAAGC
CTGTGGGTACGCCAGTCGCGCCCGTATGCGGGAGACACCTACGGCCTGCACCTGCCGCTGCTGGCGGGAA
CGGAAGTCAGCATCGCCTTTGAGGAAGGCAACCCGGACCGACCGTATATCGCCGGGGTAAAACACGACTC
GGCACACACCGACCATGTGACCATTCAGAACTACAAGCGCAACGTGCTGCGCACCCCGGCGAACAACAAA
ATCCGCCTCGATGATGAGCGCGGCAAAGAGCATATCAAGGTCAGTACCGAGTACGGCGGCAAGAGCCAGT
TGAATCTGGGTCATCTGGTGGATGCCGGAAAACAACAGCGCGGGGAAGGCTTTGAACTGCGTACCGATAT
GTGGGGCGCGGTGCGGGCGAAGAAAGGGATTTTTATCAGCGCCGATGCGCAGGATAAGGCGCAGGGGCAG
GTGCGCGAAATGGCTCCGGCGATGGCAATACTGGATGGCGCACAGTCACAGATGCAGTCGCTGTCCACTG
ATGCGCAGACGACGAATGCCGATCCGGCAGATCTGTCATCGCAGATAGCGCTGTTGCAGCAAAGTGTAAA
AGATCTGACGCAGGCCGTGATCCTGCTAAGTGCACCCAAGGGCGTGGCGATCGCCAGCGGCGAGCACCTG
CAACTGGCGGCGTCGAAGAATGTGATAGCGAACGCAGGCAACAACGCAGATATCGGCGTAGTAAAAAATA
TGTTTATCGGTGTGGGTCAGGCGCTGAGCGTGTTTGTGCGTAAAGCGGGCATCAAGCTGTTTGCCAATAA
AGGGGCGGTCTCGGTACAGGCACAGAACGATCTGATGGAACTGTTGGCACAGAAATCGATAGAGATCACC
AGTACGGAAGATGAGATCAAGATCACCGCGAAGAAGAAAATCACCCTTAACGGCGGTGGCAGCTACATCC
GGCTGGATGCCTGCGGGATAGAAGCGGGAACGCCGGGAGAATATAACGTTAAGGCCGGATATTACGGGCG
TAAACCAAAGGCGAAGCTGACGCCGGAGCTGATGGCATTTCCGGTGATTAAGTCTGAGGATTTTAATCAG
AGCTTTATTTTGCTGGATGAAAATACTGGGCAACCACTTATTAATTGGCCCTATGAACTAGAACTGGAAA
GTGGGCTAAAAATGAGTGGGATTACTGATGAAAATGGAAATACAGAACTAATATCCTCTGATAAGGAGGA
GGTCGTTAATATTAGTGTGTTTGAACCCGATGAGTTTTTAGACGATGACATTAATTAA
 Primer design