SecReT6
Protein ID: 260845471
SecReT6 ID366
T6SS typei2
Gene symbol-
Locus tagECO103_3368
StrainEscherichia coli O103:H2 str. 12009
Repliconchromosome [GenBank: NC_013353] [Browse all T6SS(s) in this replicon]
Location [Strand]3429396..3432722 [+]
Producthypothetical protein
NoteTssM
UniProt IDC8UAF7
KEGG IDeoh:ECO103_3368
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 6.10E-66, Aligned region: 393..710
IcmF-related [PF06761], Evalue: 6.10E-66, Aligned region: 771..812
DUF1215 [PF06744], Evalue: 1.30E-35, Aligned region: 427..460
DUF1215 [PF06744], Evalue: 1.30E-35, Aligned region: 831..950
Protein Sequence: 1108 a.a.     [Download]
>gi|260845471|ref|YP_003223249.1| hypothetical protein ECO103_3368 [Escherichia coli O103:H2 str. 12009]
MTVAVVVALCTFIHRKPALLGVEPGSSQQMYWMAGVIAAGVVFLIIMGVYHLLNRHAAVQNFELRRQLAA
GDDYRAVTTKKADSRHPAMVELAAFLRDRYGPFWRRNVRLLLVTGEPEQAEAIAPGLTGQHWLEGDHTVL
IYGGRPSAEPDVTLLTALKKLRRSRPLDGIIWALTEEQSRQTAQLDKGWRELINGGKRLGFQAPLYLWQV
CDNGDYQAGRPLQSVGCLLPERCTPEQLTAMLEAHTLPLTEQGMSQLLADNRHDFLLRLAHTLAERGIAH
WQSVLKPLLAGGAFSSLRLRGLMFSPPLTAVPEAAPHAWLPSQVWAGVTGDNARGRAVGFPWLRAALMSA
VCVLAIWGAGMTTSFFANCALVQETGIQTARALDTRLPLAEQLVALHTLQGELERLQYRIREGAPWYQRF
GLERNQQLLAAAFPGYAQAANRLVRDVAVDHLQQQLNAFVALPPNSPQRTATGEQRYKQLKALLMTSRPE
KADAAFFSTTLMADSLRYENIPEGVQQSVFPSLLTFWMANLPEHPQWKTSPPPELTGAVRKILLRQIGVR
NAENTLYQNVLQQVSRNYADMTLADMTGDTLTESLFSTEQTVPGMFTRQAWEGQVREAIEQVVTARHEEI
DWVLSDRQQDTSADISPDTLRNRLTSRYFTDFTGSWLAFLNSIRWKKEDSLSGILDQLTLMADARQSPLI
ALTDTLAWQAAAGRENRGLSDSLAKSAQELFNGKEKTPQQSREGDVPVGPLDKTFAPLLRLLGDKAGGGD
SQLSLQTYLTRVTRVRLKLQQVTNAPDPQEMTQQLAQTVLQGKTVDLTDTRDYGRLIAASLGEEWSGFGQ
ALFVRPVEQSWRQVLTPAADSLNRQWQRAIVSHWNQDFAGRYPFKASQNDASLPLLAQYLRDDGRINQFI
AANLSGVLKREGRYWVADAMNTQGLTVNPDFIRALNRLRDVADTAFASGDAGIHFELQAKPARDVMKTHL
VIDGQELEYFNQKERWQRFNWPDEQWQPGASLSWTSTQAMERILADYRGSWSLIRLLEQAQVTPVDSSTF
KVVWKAQDGLPLNYLLRVEQGKGPLALLELKNFRLPGQVFLTGRSMKDAEEYGEDADE
 
Nucleotide Sequence: 3327 bp     [Download]
>gi|260842239|ref|NC_013353.1|:3429396-3432722 Escherichia coli O103:H2 str. 12009, complete genome
ATGACCGTGGCTGTTGTGGTTGCGCTTTGCACGTTTATTCACCGTAAACCGGCATTGCTGGGCGTTGAAC
CGGGTAGCTCACAGCAAATGTACTGGATGGCTGGCGTGATTGCCGCAGGCGTGGTCTTTTTGATTATCAT
GGGGGTTTATCATCTGCTGAACCGCCACGCTGCCGTACAAAACTTTGAACTCCGCAGACAACTTGCCGCC
GGAGATGACTATCGTGCGGTGACGACAAAGAAAGCCGACAGCCGTCATCCGGCAATGGTGGAACTCGCCG
CCTTCCTGCGCGACCGCTACGGTCCGTTCTGGCGGCGTAACGTCCGCCTGCTGCTGGTGACCGGCGAGCC
TGAACAGGCAGAAGCCATCGCGCCGGGGCTGACCGGGCAACACTGGCTGGAGGGCGACCACACGGTGCTG
ATATATGGCGGCAGGCCATCAGCGGAGCCTGATGTCACACTGCTGACCGCCTTAAAAAAACTGCGCCGCA
GCCGTCCGCTGGACGGCATCATCTGGGCGCTGACAGAAGAACAGAGCCGCCAGACAGCGCAACTCGACAA
AGGCTGGCGCGAACTGATAAACGGCGGTAAGCGACTCGGTTTTCAGGCCCCACTCTATTTGTGGCAGGTC
TGTGACAACGGTGATTATCAGGCCGGACGCCCCCTGCAAAGCGTCGGCTGCCTGCTGCCGGAACGCTGCA
CCCCGGAACAACTGACCGCCATGCTGGAAGCTCACACCCTGCCGCTGACGGAACAGGGCATGTCGCAACT
GCTGGCTGATAACCGCCATGATTTTCTGCTGCGTCTGGCCCATACCCTTGCAGAGCGGGGTATCGCTCAC
TGGCAAAGCGTCCTGAAACCGCTGCTGGCAGGCGGCGCATTCTCTTCCCTGCGCCTGCGTGGTCTGATGT
TCAGCCCGCCGCTTACCGCCGTACCGGAGGCCGCACCTCATGCGTGGCTGCCGTCACAGGTCTGGGCGGG
CGTGACCGGCGATAACGCACGGGGGCGTGCAGTGGGCTTTCCGTGGCTACGCGCCGCGCTGATGTCCGCT
GTCTGCGTGCTGGCAATATGGGGGGCCGGAATGACGACCTCTTTCTTCGCCAACTGCGCTCTTGTTCAGG
AAACCGGTATCCAGACGGCGCGGGCGCTCGATACCCGCCTGCCGCTGGCAGAACAACTGGTGGCGCTGCA
TACCCTGCAGGGCGAACTGGAACGCCTGCAATATCGTATCCGCGAAGGTGCGCCGTGGTATCAGCGTTTT
GGCCTTGAACGTAACCAACAACTGCTCGCCGCCGCCTTTCCCGGCTATGCGCAGGCGGCAAACCGGCTGG
TGCGCGACGTGGCCGTTGACCATCTGCAACAGCAACTGAACGCCTTTGTCGCCCTGCCGCCCAACAGTCC
TCAGCGTACCGCCACCGGTGAACAACGCTATAAGCAGCTTAAGGCATTGCTGATGACTTCCCGCCCGGAA
AAGGCCGACGCTGCCTTTTTCAGTACCACGCTGATGGCAGACAGCCTGCGCTACGAGAATATCCCGGAAG
GTGTGCAGCAGAGCGTGTTTCCGTCACTGCTGACCTTCTGGATGGCGAACCTGCCGGAACACCCGCAGTG
GAAAACCTCGCCGCCACCGGAACTGACCGGCGCGGTGCGTAAAATCCTGCTGCGCCAGATTGGTGTGCGT
AATGCCGAAAACACTCTCTACCAGAACGTACTGCAACAGGTGTCCCGCAACTACGCCGATATGACGCTGG
CGGACATGACCGGGGATACCCTCACCGAATCTCTTTTCAGTACGGAACAGACGGTGCCGGGGATGTTCAC
CCGTCAGGCGTGGGAAGGACAGGTCAGGGAAGCCATCGAGCAGGTGGTGACGGCGCGGCACGAGGAAATC
GACTGGGTGCTCAGCGACCGCCAGCAGGATACCTCTGCGGATATATCGCCGGATACGCTGCGTAACCGTC
TCACCTCACGCTACTTTACCGACTTCACCGGAAGCTGGCTGGCGTTTCTCAACAGCATTCGCTGGAAAAA
GGAAGACTCGCTCTCCGGCATTCTCGACCAGCTGACACTGATGGCCGATGCCCGTCAGTCGCCGCTGATT
GCGCTGACCGATACCCTCGCCTGGCAGGCGGCGGCAGGCAGGGAAAACCGTGGCCTGTCAGACTCGCTGG
CGAAATCGGCACAGGAACTGTTTAACGGCAAGGAGAAAACGCCGCAGCAATCCCGTGAAGGCGACGTGCC
TGTCGGGCCGCTGGATAAAACCTTCGCTCCGCTGCTGCGGTTGCTGGGCGATAAAGCCGGAGGCGGCGAC
AGCCAGCTGAGTCTGCAGACCTACCTCACCCGCGTTACCCGTGTGCGTCTCAAACTGCAACAGGTGACCA
ACGCCCCCGACCCGCAGGAAATGACGCAACAGCTGGCACAGACGGTACTGCAGGGCAAAACCGTTGACCT
CACCGACACCCGCGACTACGGACGGTTAATCGCCGCCAGTCTGGGCGAGGAATGGAGTGGCTTCGGTCAG
GCGCTGTTCGTCCGCCCGGTGGAGCAGTCGTGGCGGCAGGTGCTGACGCCTGCGGCGGACAGCCTGAACC
GCCAGTGGCAGCGGGCGATTGTCAGCCACTGGAATCAGGACTTCGCTGGTCGCTACCCGTTCAAAGCCTC
ACAGAACGATGCCTCCCTCCCCCTGCTGGCGCAGTATCTGCGCGATGACGGGCGCATCAACCAGTTTATT
GCCGCCAACCTTTCCGGCGTTCTGAAACGTGAAGGCCGCTACTGGGTGGCGGACGCCATGAACACGCAGG
GGCTGACGGTCAACCCGGACTTTATCCGCGCCCTGAACCGCCTGCGCGACGTGGCTGACACCGCCTTTGC
CAGCGGCGATGCCGGAATACATTTTGAACTGCAGGCAAAACCGGCCCGAGACGTGATGAAGACACATCTG
GTGATTGACGGGCAGGAACTGGAGTATTTCAACCAGAAAGAACGCTGGCAGCGTTTCAACTGGCCGGATG
AACAGTGGCAACCCGGCGCATCGCTGAGCTGGACCAGTACGCAGGCGATGGAACGCATACTGGCGGATTA
CCGGGGGAGCTGGAGCCTTATTCGCCTGCTGGAACAGGCGCAGGTGACACCGGTGGACAGCAGCACCTTT
AAAGTGGTGTGGAAAGCGCAGGACGGCCTGCCGCTGAATTACCTGCTGCGGGTTGAACAGGGTAAAGGGC
CGCTGGCGCTGCTGGAACTGAAAAACTTCCGCCTGCCGGGACAGGTATTTCTGACCGGCAGGAGTATGAA
AGATGCGGAAGAATACGGGGAAGACGCCGATGAGTGA
 Primer design