SecReT6
Protein ID: 260845472
SecReT6 ID366
T6SS typei2
Gene symbol-
Locus tagECO103_3369
StrainEscherichia coli O103:H2 str. 12009
Repliconchromosome [GenBank: NC_013353] [Browse all T6SS(s) in this replicon]
Location [Strand]3432715..3434325 [+]
Producthypothetical protein
NoteTssA
UniProt IDC8UAF8
KEGG IDeoh:ECO103_3369
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.40E-19, Aligned region: 66..126
ImpA-rel_N [PF06812], Evalue: 1.40E-19, Aligned region: 459..477
Protein Sequence: 536 a.a.     [Download]
>gi|260845472|ref|YP_003223250.1| hypothetical protein ECO103_3369 [Escherichia coli O103:H2 str. 12009]
MSELLQKLTRSCFVDRDALDVARTQAALWQTWLLPVTANTPVGEDPGYHDDFLRIRDEMNKLSGADTDLI
CQLAESLLLTQAKDVRIATYYIWARLHRDGERGLAEGLALLTGLVERFGTQLLPSRPASRKMALEWLAGE
KMLDSLARYPEVAKEDFANIVAALSQLTVSFTAWPEDQHSPSLMLLINALESRLAQSGGMNAVVPQNSSS
VPAPSSPVDAPQVQTITSGRDLLDQAKVLARYLNEQPQGWLSAHRLMKTLRWDTVHELPPDVDGKTRLAP
PRTESRNQLKRLYAQQNWTELLEQADLMFSTGVSHFWLDIQWYLHQALTKAGAPWDRWTAVIRQDLALLL
ERLPGLENLAWNDDTPFADEVTRNWIAQQVMMREDGAWLAGKAAVPTDDATNDVLALEPEALEMADSQGV
EAALGWIQTRPGITTARQRLLLRLLMARVAEQYGKNEMALLLLEELDTAAQGLTLTQWEPDLLFEVKARQ
LKLLRLRAHRYADKALLNRKMEILLGTLVTIDPVRAAVLCDTQHKD
 
Nucleotide Sequence: 1611 bp     [Download]
>gi|260842239|ref|NC_013353.1|:3432715-3434325 Escherichia coli O103:H2 str. 12009, complete genome
ATGAGTGAACTGTTGCAAAAGCTGACCCGTAGCTGTTTTGTCGACCGGGATGCACTGGATGTGGCGCGAA
CACAGGCAGCGCTGTGGCAGACATGGCTGCTGCCGGTGACGGCAAATACGCCGGTCGGGGAAGACCCCGG
CTACCACGACGATTTCCTGCGTATCCGCGACGAGATGAACAAACTTTCCGGCGCGGATACGGACCTCATC
TGCCAGCTTGCCGAATCCCTGCTGCTGACGCAGGCAAAAGACGTGCGCATCGCCACTTACTACATCTGGG
CGCGACTGCACCGCGACGGTGAGCGCGGACTGGCTGAGGGGCTGGCGCTACTGACCGGACTGGTGGAACG
CTTCGGTACGCAACTGCTGCCCTCGCGACCGGCCAGCCGGAAAATGGCGCTGGAGTGGCTGGCAGGGGAA
AAGATGCTCGACAGTCTTGCCCGCTACCCGGAAGTGGCAAAAGAGGATTTTGCGAACATTGTTGCTGCCC
TCAGTCAGTTGACGGTTTCCTTCACTGCATGGCCCGAAGACCAGCATTCCCCCTCCCTGATGCTGCTGAT
TAACGCGCTGGAATCACGTCTGGCGCAGTCGGGCGGGATGAACGCGGTGGTGCCGCAAAACAGCAGCAGC
GTTCCTGCACCGTCATCCCCGGTGGATGCGCCACAGGTACAGACCATCACCTCCGGGCGTGACCTGCTCG
ACCAGGCGAAAGTGCTGGCCCGTTATCTGAACGAACAGCCGCAGGGCTGGCTTTCGGCGCACCGGCTGAT
GAAAACCCTGCGCTGGGACACAGTGCATGAACTGCCGCCGGATGTGGACGGCAAAACCCGGCTGGCCCCG
CCGCGCACCGAGTCACGCAACCAGCTTAAGCGGCTGTATGCGCAGCAGAACTGGACGGAACTGCTGGAGC
AGGCCGACCTGATGTTCAGCACCGGCGTCAGCCATTTCTGGCTGGATATCCAGTGGTATCTGCATCAGGC
GCTGACTAAGGCGGGCGCACCGTGGGACAGGTGGACAGCCGTTATCCGTCAGGACCTGGCGCTGCTGCTG
GAACGTCTGCCAGGGCTGGAAAATCTGGCATGGAACGACGACACACCGTTCGCCGACGAGGTGACGCGCA
ACTGGATAGCGCAGCAGGTCATGATGCGGGAAGACGGCGCATGGCTTGCAGGGAAAGCCGCTGTACCGAC
AGACGACGCCACAAATGACGTACTGGCGCTGGAGCCGGAAGCACTGGAGATGGCAGACAGTCAGGGCGTG
GAAGCGGCTCTGGGCTGGATACAGACCCGTCCGGGCATCACCACGGCACGCCAGCGCCTGTTATTGCGAC
TGCTGATGGCGCGGGTGGCGGAACAGTACGGTAAAAACGAAATGGCGCTCCTGCTGCTGGAAGAACTGGA
TACCGCCGCACAGGGGCTGACACTGACGCAGTGGGAGCCGGACCTGCTGTTTGAGGTAAAAGCCCGACAA
CTGAAACTGCTGCGCCTGCGGGCGCACCGCTATGCGGATAAAGCCCTGCTGAACCGAAAAATGGAAATCC
TGCTGGGAACGCTGGTGACAATCGATCCGGTACGGGCAGCGGTATTGTGTGATACGCAACATAAGGACTG
A
 Primer design