SecReT6
Protein ID: 260845473
SecReT6 ID366
T6SS typei2
Gene symbol-
Locus tagECO103_3370
StrainEscherichia coli O103:H2 str. 12009
Repliconchromosome [GenBank: NC_013353] [Browse all T6SS(s) in this replicon]
Location [Strand]3434325..3435749 [+]
Producthypothetical protein
NotePAAR
UniProt IDC8UAF9
KEGG IDeoh:ECO103_3370
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 7.90E-11, Aligned region: 11..68
Protein Sequence: 474 a.a.     [Download]
>gi|260845473|ref|YP_003223251.1| hypothetical protein ECO103_3370 [Escherichia coli O103:H2 str. 12009]
MAMGTGYFLVRGDKTTCGGKIIGGADDHTIMGIPQARDMDRVTCGRYPGMFIIVGGVPETDIHGRLMAGT
LDSQSSCPCKARFIASMMDDTYETDDGGSEAEQHAQSAKKDLTSGSDSSSDDVKLDYRIKLSGNKILTPL
NIPDYKEMISGGSTKNTEKIDFTITNKGDEAEGLSLEVLDGNEVIYSEQQTGKYFDKGEHAWQWDGYSNQ
GILDTTKLKSKSLLVRLIALCGDMMIKVDYPLHNSPEEQKWVDVKVDRKQKTVDIIWRLAVSDGGIKGSN
PKLSPVPYNDLVNLTKNGVEFYWSRNGSRGGGIGENIVTAIGVFKVNVKAEINITPSMRTFSLISSLDPD
FQASVSLSGFEKIYYNYGDSYKDIQDELQALLDANNRYKWDSAHEMGHKVLDEYGEGSSPDYSWTHKGTS
TLMQKTIPGNVMPAQGEIDVMKYGKYRPDMYTRLVAADEDVQGLIWLSRIKFDD
 
Nucleotide Sequence: 1425 bp     [Download]
>gi|260842239|ref|NC_013353.1|:3434325-3435749 Escherichia coli O103:H2 str. 12009, complete genome
ATGGCAATGGGAACAGGCTACTTTCTGGTCAGGGGGGACAAAACCACCTGCGGCGGGAAGATTATTGGAG
GCGCGGACGACCATACGATCATGGGTATCCCACAGGCACGGGATATGGACCGGGTCACCTGCGGCAGATA
TCCGGGAATGTTTATTATTGTGGGCGGCGTTCCTGAAACAGATATTCACGGCAGGCTGATGGCGGGGACG
CTGGACAGCCAGAGCAGTTGCCCCTGTAAGGCACGGTTTATTGCGTCGATGATGGATGATACGTATGAGA
CGGATGACGGGGGAAGTGAAGCGGAACAACATGCGCAGTCGGCGAAAAAGGATCTGACTTCTGGTTCTGA
TTCATCCTCTGATGATGTAAAACTGGATTACAGAATTAAATTATCAGGTAATAAGATACTGACGCCACTG
AATATACCTGATTATAAAGAAATGATAAGCGGTGGTAGTACGAAGAATACAGAAAAAATAGATTTTACTA
TCACAAATAAAGGCGATGAGGCTGAAGGACTTTCTCTGGAAGTGCTTGATGGTAATGAAGTGATTTACAG
TGAACAGCAGACCGGTAAATATTTTGATAAGGGAGAGCATGCCTGGCAATGGGATGGCTACAGTAATCAA
GGCATACTGGATACAACTAAGCTAAAAAGCAAATCACTACTCGTAAGACTGATTGCTTTATGTGGTGATA
TGATGATAAAAGTTGATTATCCACTTCATAATTCACCAGAGGAACAAAAATGGGTCGATGTAAAGGTAGA
CAGAAAACAAAAAACAGTAGATATAATATGGCGACTGGCAGTTAGTGATGGAGGGATAAAAGGAAGTAAT
CCTAAGTTATCCCCAGTTCCTTATAACGACTTGGTTAACCTGACCAAAAATGGAGTTGAATTTTATTGGT
CTCGAAATGGAAGTCGCGGCGGGGGGATTGGTGAAAATATTGTTACAGCGATTGGTGTTTTTAAAGTAAA
TGTAAAGGCTGAGATAAATATTACTCCATCCATGCGAACTTTTTCTTTGATATCATCATTAGATCCTGAC
TTTCAGGCATCCGTTAGTCTATCAGGATTTGAAAAAATATATTATAACTACGGTGATAGTTATAAGGATA
TTCAAGATGAATTACAGGCGCTTCTTGACGCTAATAACAGATATAAATGGGATAGTGCTCATGAAATGGG
GCATAAAGTACTCGATGAATATGGAGAGGGTTCTAGCCCTGATTATTCGTGGACTCATAAAGGAACATCT
ACTCTTATGCAAAAAACAATACCAGGGAATGTTATGCCCGCTCAGGGAGAGATTGATGTAATGAAATATG
GAAAATATCGTCCTGACATGTATACTCGATTGGTTGCAGCAGATGAAGATGTTCAGGGATTGATCTGGTT
AAGCAGGATAAAATTTGATGACTAG
 Primer design