SecReT6
Protein ID: 260845474
SecReT6 ID366
T6SS typei2
Gene symbol-
Locus tagECO103_3371
StrainEscherichia coli O103:H2 str. 12009
Repliconchromosome [GenBank: NC_013353] [Browse all T6SS(s) in this replicon]
Location [Strand]3436724..3438484 [+]
Producthypothetical protein
NoteTssF
UniProt IDC8UAG0
KEGG IDeoh:ECO103_3371
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.40E-183, Aligned region: 6..583
Protein Sequence: 586 a.a.     [Download]
>gi|260845474|ref|YP_003223252.1| hypothetical protein ECO103_3371 [Escherichia coli O103:H2 str. 12009]
MDDLTQRYYEAEMRYLREAGKEFAQAYPDRAAMLNLDKPGARDPYVERLFEGFAFLMGSLREKLDDDLPE
LTEGLVSLLWPHYLRTIPSLSVVELSTDHRQMKQSETLSDFQVLSRPVGERRTRCFYSATRDITLHPLAL
PDVSLQYEPDGRSVIRLRFECGPLVGDWSQIDLSRLPFYLNADSPVACALHRALTLGTQQFWLRLPGQDR
RTLDAHFSPLGFEDNDRLWPKGESAFSGYQLLLEYFTFREKFMFVALNGLELVAWPEGITGFEIDVVLNE
NWPHDLPFDSDNIRLHCVPVINLFPLEADPLHLSPLENEFLLRPMRIQDGHTEIYSVDNIISSRHTGSQA
YVPFSSFRHRGGMLRHDAPERYYHTRVKRGPSGLHDTWLILGGDAFDADRMLEDETLSLSLTGTNGHLPR
KALQSTLLDRPVHASQNVLRVRNLCAPTQPCYPPARDRFHWRVLSHLGSNFLSMMDNAEILRGTLALYDW
TESEMNRRRLEAIVDVQHSLIQRFERGFLLRGVDIQVTLDSNGFAGEGDITLFGELLHRFFALYADIHLF
TQLTLILQPTGKCLQWTEHHSQRVPG
 
Nucleotide Sequence: 1761 bp     [Download]
>gi|260842239|ref|NC_013353.1|:3436724-3438484 Escherichia coli O103:H2 str. 12009, complete genome
ATGGACGACTTAACCCAACGCTACTACGAAGCCGAAATGCGCTACCTGCGTGAAGCGGGGAAAGAATTTG
CGCAGGCTTACCCCGACCGCGCCGCGATGCTCAATCTTGATAAACCCGGCGCACGCGATCCCTATGTGGA
ACGCCTGTTCGAAGGCTTTGCTTTTTTAATGGGCAGCCTGCGCGAGAAGCTGGACGACGATCTGCCGGAG
CTGACTGAAGGGCTGGTCAGCCTGCTGTGGCCTCACTACCTGCGAACTATCCCGTCACTTTCCGTGGTTG
AACTGTCGACAGATCACCGGCAGATGAAGCAGAGCGAAACGCTGAGCGATTTTCAGGTATTGTCGCGCCC
TGTTGGCGAGCGCAGAACCCGCTGTTTCTACAGCGCCACGCGGGATATCACGCTGCATCCGCTGGCGTTG
CCGGACGTGTCATTGCAATATGAACCGGACGGACGTTCGGTTATTCGTCTGCGCTTTGAATGCGGCCCGC
TGGTCGGTGACTGGTCACAGATCGATTTATCCCGCCTGCCGTTCTATCTCAATGCCGACAGTCCGGTGGC
CTGTGCGCTGCACCGGGCTTTAACGCTTGGTACGCAGCAGTTCTGGTTGCGTCTGCCGGGGCAGGATCGC
CGGACGCTTGACGCACACTTTTCCCCGTTGGGCTTTGAGGATAATGACAGGCTCTGGCCAAAAGGCGAGT
CGGCGTTCAGCGGCTACCAGTTGCTGCTGGAGTATTTCACCTTCCGCGAGAAGTTTATGTTTGTGGCACT
CAACGGGCTTGAGCTGGTTGCATGGCCGGAGGGGATAACCGGCTTTGAGATTGACGTGGTGCTGAACGAG
AACTGGCCTCACGACCTGCCGTTTGACAGCGATAATATCCGTCTGCACTGCGTGCCGGTCATCAATCTGT
TCCCGCTCGAAGCCGATCCGTTACACCTTTCGCCACTGGAAAACGAATTTCTGCTACGCCCGATGCGCAT
TCAGGACGGGCATACCGAGATTTATTCCGTCGACAACATTATTTCTTCGCGCCATACCGGCAGTCAGGCG
TATGTCCCCTTCTCCAGCTTTCGTCACCGGGGCGGGATGCTGCGCCACGATGCGCCGGAACGCTATTACC
ACACGCGGGTAAAGCGCGGCCCTTCCGGTCTGCATGACACCTGGCTGATTCTGGGCGGTGATGCGTTTGA
TGCTGACCGGATGCTGGAGGATGAAACGCTCTCTTTAAGCCTGACCGGTACTAACGGGCATCTTCCCCGT
AAGGCTTTACAGAGCACGCTGCTCGATAGGCCAGTTCATGCCTCACAGAACGTCCTGCGGGTGCGCAACC
TGTGCGCCCCAACGCAGCCCTGCTATCCCCCGGCGCGTGACCGCTTCCACTGGCGGGTGCTCAGCCACCT
TGGTTCTAACTTTTTATCGATGATGGATAACGCCGAAATTCTGCGCGGAACGCTGGCGCTGTACGACTGG
ACCGAAAGCGAGATGAACCGCCGTCGTCTGGAGGCGATTGTCGACGTTCAGCACAGCCTGATACAGCGTT
TTGAAAGAGGCTTTCTGCTGCGTGGCGTGGATATTCAGGTGACGCTGGACAGTAACGGCTTTGCCGGAGA
AGGTGATATCACGCTGTTTGGTGAACTGCTGCACCGCTTTTTCGCACTGTATGCCGATATCCACTTATTC
ACTCAACTGACCTTAATTCTGCAACCTACAGGAAAGTGCCTGCAATGGACAGAGCATCACAGCCAGCGCG
TACCGGGCTGA
 Primer design