SecReT6
Protein ID: 260845475
SecReT6 ID366
T6SS typei2
Gene symbol-
Locus tagECO103_3372
StrainEscherichia coli O103:H2 str. 12009
Repliconchromosome [GenBank: NC_013353] [Browse all T6SS(s) in this replicon]
Location [Strand]3438448..3439527 [+]
Producthypothetical protein
NoteTssG
UniProt IDC8UAG1
KEGG IDeoh:ECO103_3372
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.70E-80, Aligned region: 19..319
Protein Sequence: 359 a.a.     [Download]
>gi|260845475|ref|YP_003223253.1| hypothetical protein ECO103_3372 [Escherichia coli O103:H2 str. 12009]
MDRASQPARTGLTDRLAPDIARINFYRFCQFLEQSQQNAPLGSTDNPATDAVRFRPHPGMGFPVSELKNV
ERDAGNPNVPPTVRTTFLGLYGVDSPLPTAYLDYITQRHDGHDAVMAFLDIFNHRFITQYYRIWRKYNYP
ASFEAGAMDDISRCLLGLIGLGIPGSENHIATPVSRFLALLSVMRLPTRTAEGVTALVGLLAPLTKATVV
PHDPQPVILPAPAGLSKNSRISLKTRTLLGRTGTDVNSQLLLKLYTEDAAEARGWLPGGQLHSDLLVLLR
VYLGWRCQARLQLTLPVSLLPAARLGKQRVQISRTGILRASFAAPATGTVTVSLGRYQGLIPALSIRNRE
SMTHVSYSF
 
Nucleotide Sequence: 1080 bp     [Download]
>gi|260842239|ref|NC_013353.1|:3438448-3439527 Escherichia coli O103:H2 str. 12009, complete genome
ATGGACAGAGCATCACAGCCAGCGCGTACCGGGCTGACCGACCGGCTGGCCCCGGATATTGCGCGGATCA
ATTTTTACCGTTTTTGCCAGTTTCTGGAACAGAGCCAGCAGAACGCGCCGCTGGGCAGTACCGACAACCC
CGCCACCGATGCGGTGCGCTTTCGTCCCCATCCCGGAATGGGCTTTCCGGTCAGCGAGTTAAAGAACGTT
GAACGTGACGCGGGCAATCCCAACGTGCCACCCACGGTGCGCACCACCTTTCTCGGCCTGTACGGCGTGG
ATTCGCCGCTGCCAACCGCCTATCTGGACTACATTACCCAGCGTCATGACGGACATGACGCAGTGATGGC
GTTTCTCGATATTTTTAACCATCGCTTTATCACCCAGTATTACCGCATCTGGCGCAAATATAACTACCCG
GCGTCGTTTGAAGCAGGTGCTATGGATGACATTTCCCGTTGTCTGCTGGGACTCATCGGGCTGGGTATTC
CCGGCAGCGAGAACCATATCGCCACGCCGGTATCCCGTTTTCTGGCCCTGCTCAGCGTGATGCGCCTGCC
GACGCGCACGGCGGAAGGCGTCACGGCACTGGTGGGACTGCTTGCCCCGCTGACGAAAGCGACGGTGGTG
CCTCACGATCCGCAGCCTGTTATTCTCCCGGCCCCTGCGGGTCTGTCAAAAAATTCACGCATCAGCCTGA
AAACGCGAACGCTGCTGGGGCGTACCGGCACCGACGTCAACAGCCAGTTGCTGCTGAAACTGTATACCGA
AGATGCCGCAGAAGCACGTGGCTGGCTACCTGGCGGGCAGCTGCACAGCGATTTGCTGGTGCTGCTGCGC
GTTTATCTGGGCTGGCGCTGTCAGGCCCGTCTGCAACTGACGCTGCCCGTCAGCCTGTTGCCTGCTGCCC
GGCTGGGAAAACAGCGCGTACAGATTAGCCGTACCGGCATCCTTCGCGCCTCCTTTGCCGCGCCCGCGAC
CGGAACAGTGACGGTCAGTCTGGGGCGTTATCAGGGATTAATACCCGCTTTATCCATTCGTAACAGGGAG
AGTATGACTCATGTTTCCTATTCGTTTTAA
 Primer design