SecReT6
Protein ID: 260845477
SecReT6 ID366
T6SS typei2
Gene symbol-
Locus tagECO103_3374
StrainEscherichia coli O103:H2 str. 12009
Repliconchromosome [GenBank: NC_013353] [Browse all T6SS(s) in this replicon]
Location [Strand]3440048..3440476 [+]
Producthypothetical protein
NoteTssE
UniProt IDC8UAG3
KEGG IDeoh:ECO103_3374
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.90E-16, Aligned region: 25..114
Protein Sequence: 142 a.a.     [Download]
>gi|260845477|ref|YP_003223255.1| hypothetical protein ECO103_3374 [Escherichia coli O103:H2 str. 12009]
MSTPSLYEMLTFSFSGELPLEQVSERDQLILSVMDNMQRIINCRAGTLAHLPDYGLPDLSLIHQGMVAGI
HGLMRQIEETLLRYEPRLSQIQVELLPQPRPGYLNYLIHAQLPDTGWIRFDGVFSPEGRIVLRHLKQQER
AY
 
Nucleotide Sequence: 429 bp     [Download]
>gi|260842239|ref|NC_013353.1|:3440048-3440476 Escherichia coli O103:H2 str. 12009, complete genome
ATGTCGACACCTTCCTTATATGAAATGCTGACGTTCAGTTTCAGCGGCGAGTTACCACTGGAACAGGTCA
GCGAGCGGGATCAGCTTATCCTTTCCGTGATGGACAATATGCAACGCATTATCAACTGTCGGGCAGGCAC
ACTGGCGCATTTGCCGGATTACGGTCTGCCGGATCTCAGTCTGATCCATCAGGGTATGGTTGCGGGTATT
CATGGCCTGATGCGTCAGATTGAAGAAACGCTGCTGCGTTATGAACCACGCCTGAGTCAGATACAGGTGG
AGTTACTCCCCCAGCCCCGTCCGGGGTATCTTAATTACCTGATCCACGCGCAGCTTCCCGATACCGGCTG
GATACGCTTTGATGGCGTGTTTTCTCCGGAAGGACGAATTGTTCTGCGTCATCTCAAACAGCAGGAGCGG
GCGTACTGA
 Primer design