SecReT6
Protein ID: 260845478
SecReT6 ID366
T6SS typei2
Gene symbol-
Locus tagECO103_3375
StrainEscherichia coli O103:H2 str. 12009
Repliconchromosome [GenBank: NC_013353] [Browse all T6SS(s) in this replicon]
Location [Strand]3440476..3441852 [+]
Producthypothetical protein
NoteTssA
UniProt IDC8UAG4
KEGG IDeoh:ECO103_3375
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 3.00E-48, Aligned region: 117..127
DUF3702 [PF12486], Evalue: 3.00E-48, Aligned region: 306..449
ImpA-rel_N [PF06812], Evalue: 2.00E-15, Aligned region: 42..100
ImpA-rel_N [PF06812], Evalue: 2.00E-15, Aligned region: 358..376
Protein Sequence: 458 a.a.     [Download]
>gi|260845478|ref|YP_003223256.1| hypothetical protein ECO103_3375 [Escherichia coli O103:H2 str. 12009]
MASNANFISQFVMGGDPCTYKESGELQAEMSKLTHPARPDVDWRRVEKLSLALFRQNGVELQTQVCYVLA
ITRRQGLAGMADGLGSLDILLQRWADFWPVQVHSRISLLSWVTEKMQQALRTLDIQYQDLPQIYRCVQHL
SAIETTLQQCELWHMTKLDVLAGQFRNTALRLERLAPQGAETTITPPELPRREMKQPEKSEESPQPVFAT
RPAQQNDKDASPSAPSPEISWQRTWPIFMAGMVVKACLGGTGLWGWSQLNQPDALIQRIQLSVMPLPQSL
ESGELAKLDVKDKALLAQDRTIAASQMQLEQLNKLPARWPLEQGYRQLRQLDALWPDNPQVRALNAQWRK
QRELSALSTEALNGYAQAQSQLQRLSAQLDALDERKGRYLTGSELKTAVYGIRQSLKEPPLEELLRQLEE
QKQTGEVSPTLLTQIDTRLNQLLNRYVILLDTKVEQSQ
 
Nucleotide Sequence: 1377 bp     [Download]
>gi|260842239|ref|NC_013353.1|:3440476-3441852 Escherichia coli O103:H2 str. 12009, complete genome
ATGGCAAGTAACGCGAATTTTATCAGCCAGTTCGTCATGGGCGGCGATCCCTGTACTTATAAGGAATCCG
GTGAACTACAGGCTGAAATGAGTAAACTGACTCACCCGGCCCGACCTGATGTGGACTGGCGTCGGGTGGA
AAAACTCAGCCTCGCGCTGTTCCGGCAAAATGGCGTGGAATTACAGACGCAGGTCTGTTACGTACTGGCG
ATAACCAGACGGCAGGGGCTGGCAGGGATGGCAGACGGACTCGGTTCACTGGACATACTGCTCCAGCGCT
GGGCTGACTTCTGGCCGGTACAGGTACATTCCAGAATATCACTGCTCAGTTGGGTCACAGAAAAAATGCA
GCAGGCACTGAGAACGCTGGATATTCAGTATCAGGATCTGCCGCAGATTTACCGTTGTGTACAGCATCTT
TCCGCCATCGAAACCACGCTGCAACAGTGTGAACTGTGGCATATGACGAAACTGGATGTGCTGGCCGGGC
AGTTTCGTAATACGGCGCTACGTCTGGAGCGGCTGGCACCACAGGGAGCGGAAACCACTATCACTCCCCC
TGAATTACCCCGCCGGGAAATGAAGCAACCAGAAAAGTCAGAAGAAAGTCCACAGCCGGTTTTTGCAACC
AGACCCGCTCAGCAAAACGATAAGGATGCCAGTCCATCCGCGCCATCCCCTGAAATCTCCTGGCAGCGGA
CATGGCCGATATTTATGGCCGGAATGGTTGTGAAGGCCTGTCTCGGCGGAACAGGATTATGGGGCTGGTC
GCAGCTTAATCAGCCGGACGCACTAATCCAGCGAATACAACTGTCTGTCATGCCATTACCGCAGTCGCTG
GAGAGCGGCGAGCTGGCAAAGCTGGATGTAAAGGATAAGGCGCTGCTGGCTCAGGACAGAACAATTGCGG
CAAGTCAGATGCAACTGGAGCAGTTAAACAAATTGCCTGCCCGCTGGCCACTGGAGCAGGGATATCGCCA
GCTACGCCAGCTTGATGCCCTGTGGCCGGATAATCCTCAGGTCAGAGCGCTGAACGCGCAGTGGCGTAAA
CAGCGGGAGCTGAGCGCCCTGTCCACAGAGGCATTGAATGGCTACGCACAGGCGCAGAGCCAGCTACAGC
GCCTGTCGGCGCAGCTGGATGCACTGGATGAGCGTAAGGGGAGATATCTGACCGGTTCGGAACTAAAAAC
GGCGGTGTACGGCATCCGGCAGTCGTTAAAGGAGCCGCCGCTGGAAGAACTGCTTCGGCAACTGGAAGAG
CAAAAACAGACCGGAGAGGTTTCGCCGACGCTGTTGACGCAAATTGATACCCGGTTAAATCAGTTGCTGA
ATCGCTATGTAATTTTACTGGATACGAAGGTGGAACAAAGTCAGTAA
 Primer design