SecReT6
Protein ID: 260853426
SecReT6 ID483
T6SS typeN/A
Gene symbol-
Locus tagECO26_0220
StrainEscherichia coli O26:H11 str. 11368
Repliconchromosome [GenBank: NC_013361] [Browse all T6SS(s) in this replicon]
Location [Strand]245706..249230 [-]
ProductIcmF
NoteTssM
UniProt IDC8THP2
KEGG IDeoj:ECO26_0220
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 4.60E-84, Aligned region: 323..364
IcmF-related [PF06761], Evalue: 4.60E-84, Aligned region: 505..818
ImcF-related_N [PF14331], Evalue: 2.50E-62, Aligned region: 205..455
DUF1215 [PF06744], Evalue: 4.30E-34, Aligned region: 304..322
DUF1215 [PF06744], Evalue: 4.30E-34, Aligned region: 914..1033
AAA_22 [PF13401], Evalue: 9.50E-05, Aligned region: 140..273
AAA_22 [PF13401], Evalue: 9.50E-05, Aligned region: 856..887
Protein Sequence: 1174 a.a.     [Download]
>gi|260853426|ref|YP_003227317.1| IcmF [Escherichia coli O26:H11 str. 11368]
MFRLPTPRLLSGLKSALRPAMPRFKVSAFWLLILAWIFLLVWIWWKGPMWTLYEEQWLKPLANRWLATAA
WGIIALVWLTVRVMKRLQQLEKMQKQQREEAVDPLSVELNAQQRYLDRWLLRLQRHLDNRRFLWQLPWYM
VIGPAGSGKTTLLREGFPSDIIYAPEGARGAEQRLYLTPHVGKQAVIFDIDGTLCAPADADILHRRLWEH
ALGWLKEKRARQPLNGIILTLDLPDLLTADKRRREHLLQTLRSRLQDIRQHLHCQLPVYVVLTRLDLLQG
FAALFQSLNRQDRDAILGVTFTRRAHENDDWRTELNAFWQTWVDRMNLALPDLMVAQTHTRASLFSFSRQ
MQGSREPLVSLLEGLLDGENMNVMLRGVYLTSSLQRGQMDDIFTQSAARQYRLGNNPLASWPLVDTAPYF
TRSLFPQALLAEPNLATESRAWLIRSRRRLTVFSATGGVAALLLITGWHHYYNGNYQSGITVLKQAKAFM
DVPPPQGEDDFGNLQLPLLNPVRDATLAYGDWGDRSRLADMGLYQGRRIGPYVEQTYLQLLEQRYLPSLF
NGLVKAMNAAPPESEEKLAVLRVMRMLEDKSGRNNEVVKQYMAKRWSEKFHGQRDIQAQLMSHLDYALAH
TDWHAERQAGDGDAISRWTPYDKPVVSAQKELSKLPVYQRVYQSLKTRALGVLPADLNLRDQVGPTFDQV
FTSADDNKLVVPQFITRYGLQSYFVKQRDELVELTAMDSWVLNLTRNVKYSDADRAEIQHQLTEQYISDY
TATWRAGMDNLNIRNFESIGQLTGALEQVISGDQPLQRALTVLRDNTQPGVFSEKLSAKEREEALAEPDY
QLLTRLGHEFAPENSTLAVQKDKESTMQAVYQQLTELHRYLLAIQNAPVPGKSALKAVQLRLDQNSSDPI
FATRQMAKTLPAPLNRWVGRLADQAWHVVMVEAVHYMEVDWRDSVVKPFNEQLANNYPFNPRSAQDASLD
AFERFFKPDGILDTFYQQNLKLFIDNDLSLEDGDNNVIIREDIIAQLETAQKIRDIFFSKQNGLGTSFAV
ETVSLSGNKRRSVLNLDGQLVDYSQGRNYTAHLVWPNNMREGNESKLTLIGTSGNAPRSISFSGPWAQFR
LFGAGQLTGVQDGNFTVRFSVDGGAMTYRVHTDTEDNPFSGGLFSQFGLSDTLY
 
Nucleotide Sequence: 3525 bp     [Download]
>gi|260853213|ref|NC_013361.1|:c249230-245706 Escherichia coli O26:H11 str. 11368 chromosome, complete genome
GTGTTCAGATTACCAACACCCCGACTACTCAGCGGACTCAAATCAGCCCTGCGACCGGCGATGCCCCGGT
TTAAAGTCTCTGCTTTCTGGCTGCTGATACTGGCGTGGATTTTTCTGCTGGTGTGGATCTGGTGGAAAGG
CCCGATGTGGACGCTGTATGAAGAACAGTGGCTCAAACCACTGGCGAACCGCTGGCTGGCAACGGCGGCG
TGGGGGATTATTGCCCTGGTGTGGCTTACCGTCCGGGTGATGAAGCGCCTGCAACAGCTTGAAAAAATGC
AAAAGCAACAGCGCGAGGAAGCCGTTGATCCGCTCAGCGTGGAACTGAACGCCCAGCAGCGTTATCTTGA
CCGCTGGCTGCTGCGCCTGCAACGCCATCTCGACAACCGCCGTTTCCTGTGGCAGTTGCCGTGGTATATG
GTCATCGGCCCGGCGGGCAGTGGCAAAACGACACTGCTGCGCGAGGGGTTTCCGTCCGACATTATTTATG
CCCCGGAGGGCGCACGCGGCGCAGAACAACGCCTGTACCTCACGCCCCATGTCGGTAAACAGGCGGTGAT
CTTTGATATCGACGGCACACTCTGCGCTCCCGCTGATGCGGATATCCTGCATCGCCGTCTGTGGGAACAT
GCCCTCGGCTGGCTGAAGGAAAAGCGCGCACGCCAGCCGCTGAACGGGATTATTCTGACACTCGATTTAC
CCGATCTGCTGACCGCAGACAAACGCCGCCGCGAGCATCTGTTACAGACGCTGCGCAGCCGCTTACAGGA
TATACGCCAGCATCTTCACTGCCAGTTACCGGTTTACGTGGTACTGACCCGGCTTGATTTATTACAGGGT
TTTGCCGCCCTGTTCCAGTCACTCAACAGACAGGATCGCGATGCGATTCTGGGCGTCACGTTCACCCGCC
GCGCCCATGAAAATGATGACTGGCGAACAGAGTTGAATGCTTTCTGGCAGACATGGGTGGATCGAATGAA
TCTGGCGTTGCCGGATCTGATGGTCGCTCAGACTCACACCCGCGCGTCTTTATTCAGTTTTTCCCGCCAG
ATGCAGGGAAGCCGTGAACCGCTGGTGTCACTGCTTGAGGGTCTGCTTGATGGCGAAAATATGAACGTGA
TGCTGCGTGGTGTCTATCTCACCTCTTCGCTTCAGCGTGGGCAGATGGATGATATATTCACCCAGTCTGC
CGCCCGCCAGTACCGGCTGGGCAATAACCCACTGGCGTCCTGGCCCCTGGTGGACACCGCGCCTTATTTC
ACCCGCAGCCTGTTCCCGCAGGCATTACTCGCAGAGCCTAATCTGGCAACAGAGAGCCGCGCCTGGCTGA
TACGTTCCCGTCGCCGCCTGACGGTTTTCTCTGCCACAGGCGGCGTGGCAGCACTGCTGCTCATCACCGG
CTGGCATCACTATTACAACGGTAACTATCAGTCCGGCATCACCGTGCTTAAGCAGGCCAAAGCCTTTATG
GACGTGCCGCCTCCGCAGGGGGAAGATGACTTTGGCAACCTGCAACTGCCGCTCCTGAACCCGGTACGCG
ATGCCACACTGGCCTATGGCGACTGGGGCGACCGCAGCCGTCTGGCCGATATGGGACTGTACCAGGGACG
ACGTATCGGGCCTTATGTGGAACAGACCTATCTGCAACTGCTGGAGCAACGTTACCTGCCCTCGCTGTTT
AACGGGCTGGTCAAAGCGATGAACGCCGCGCCGCCGGAGAGTGAAGAAAAACTCGCGGTGCTGCGCGTAA
TGCGAATGCTGGAGGACAAAAGCGGACGTAACAATGAGGTGGTGAAGCAGTATATGGCAAAACGCTGGAG
CGAAAAATTCCACGGCCAGCGCGATATCCAGGCACAACTGATGTCCCATCTTGACTACGCGCTGGCTCAT
ACTGACTGGCATGCAGAGCGTCAGGCGGGCGACGGTGACGCCATCAGCCGCTGGACGCCATATGACAAGC
CCGTGGTATCAGCACAGAAAGAACTGAGCAAACTGCCTGTCTACCAGCGGGTTTACCAGAGCCTGAAAAC
GCGGGCGCTGGGCGTTCTTCCTGCCGACCTCAATCTGCGTGACCAGGTAGGGCCAACCTTTGACCAGGTG
TTTACATCTGCCGATGACAACAAACTGGTTGTTCCACAGTTTATCACCCGCTACGGCCTGCAAAGCTATT
TTGTAAAACAGCGCGATGAACTGGTTGAACTGACAGCGATGGATTCCTGGGTACTTAACCTCACCCGCAA
TGTGAAATACAGTGACGCCGACCGTGCGGAAATCCAGCACCAGTTGACCGAGCAGTATATCAGCGACTAC
ACCGCCACCTGGCGGGCTGGGATGGACAATCTGAATATCCGCAATTTTGAGTCCATCGGACAACTGACCG
GGGCGCTGGAGCAGGTTATCAGCGGCGACCAGCCTTTGCAGCGGGCGCTGACCGTGCTGCGTGACAACAC
ACAGCCAGGCGTCTTTTCTGAAAAACTCTCTGCCAAAGAACGGGAGGAAGCCCTGGCAGAGCCGGATTAC
CAGTTACTCACCCGCCTCGGGCATGAATTCGCCCCGGAAAACAGTACCCTGGCAGTACAGAAAGACAAAG
AAAGCACGATGCAGGCCGTGTATCAGCAACTCACCGAGTTGCACCGCTACCTGCTGGCAATCCAGAACGC
GCCTGTACCAGGGAAATCGGCGCTGAAAGCCGTGCAGTTACGGCTTGATCAGAACAGCAGCGATCCGATA
TTCGCCACCCGCCAGATGGCAAAAACGCTGCCTGCTCCGCTCAACCGCTGGGTTGGCAGGCTGGCTGACC
AGGCCTGGCATGTGGTGATGGTGGAGGCTGTTCATTATATGGAAGTGGACTGGCGCGACAGCGTGGTGAA
ACCGTTTAACGAGCAACTGGCAAATAACTATCCGTTTAATCCGCGTTCTGCACAGGATGCCTCACTGGAT
GCCTTCGAACGCTTCTTTAAACCGGATGGCATACTGGATACCTTCTACCAGCAGAACCTGAAGCTGTTTA
TCGATAATGACCTGAGTCTGGAGGATGGCGATAACAACGTCATTATTCGCGAAGATATTATTGCGCAACT
GGAAACTGCGCAGAAAATCCGTGACATCTTCTTCAGCAAACAGAACGGTCTGGGAACATCCTTTGCCGTG
GAAACGGTATCGCTTTCAGGCAATAAACGCCGCAGTGTACTGAACCTTGACGGTCAGTTAGTCGATTACA
GCCAGGGCCGTAACTATACCGCCCATCTGGTCTGGCCTAACAACATGCGCGAAGGCAACGAAAGTAAGCT
GACGCTCATCGGCACCAGCGGCAACGCGCCGCGCAGTATCAGCTTCAGCGGGCCGTGGGCGCAGTTCCGC
CTGTTCGGGGCCGGACAACTGACCGGAGTACAGGATGGCAACTTTACCGTGCGCTTTAGCGTGGACGGTG
GCGCGATGACCTACCGTGTGCATACCGACACGGAAGATAACCCGTTCAGCGGTGGGTTGTTCAGCCAGTT
TGGTCTGTCAGACACACTGTACTGA
 Primer design