SecReT6
Protein ID: 261820398
SecReT6 ID368
T6SS typei1
Gene symbol-
Locus tagPecwa_1083
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T6SS(s) in this replicon]
Location [Strand]1173051..1176548 [+]
Producthypothetical protein
NoteTssM
UniProt IDD0KJ56
KEGG IDpwa:Pecwa_1083
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.30E-92, Aligned region: 505..819
ImcF-related_N [PF14331], Evalue: 5.20E-70, Aligned region: 200..458
ImcF-related_N [PF14331], Evalue: 5.20E-70, Aligned region: 888..928
DUF1215 [PF06744], Evalue: 4.20E-31, Aligned region: 905..1023
Protein Sequence: 1165 a.a.     [Download]
>gi|261820398|ref|YP_003258504.1| hypothetical protein Pecwa_1083 [Pectobacterium wasabiae WPP163]
MFKTIITFLRKQLPKLKPSWLLLGALLWVVVLVLAWWLGPRLTVGESRPLQGIWGRVVFTLVWLWLAFSY
SAWLVWRRVQLMRSERHEQQVTEQDPLQVYVDGQQTFLDRWLDAFQTQLGKKALYAMPWYLTIGLAGSGK
SSLIHRANPANKMNPKLDAELRDVAAGQQVSSWVGESAVIWDPSGQLLAQPELEGDALGQRHARLWQHLL
QWLSENRRRQPLNGLVLTLDISWLAQAGVADRKAYAQVMRARLQEISVSINTRLPVYIALTRLDMLSGFD
KVYRQLNRDARQAVLGVTFTPQASNSKGWLEELERFWDEWVTHLNDNLPDMLLTQSDRSVRNSLFSFVRQ
LAGVKDYVMEVLTETLAIGEDRAFLIRGVYVSSVYQQGVPFDAFAQSASRRYQLPEPINPALRGESNTFF
VQRLFPDVIFPEASLAGENRLHSLYRRRRLSIGVGCMLLAGLVLVGSWHHFYRVNEEAGRNVLTKAQAFI
GTNELEGQPGYGYQQLPRLNLIRDATLSFGNYHERTPLLADLGLYQGDKIGPYVEGTYLQMLNQRFLPAV
MQGLLEDLNQAPANSEQKLTILRVMRMLDDASGRNKALVEQFMAQRWQKAFPAQGQVQEELMQHLDYALD
HTNWHQSREQKDAVAISTFAPFNGPITLAQQELSKLPMYQRVYQSLVMKATQVLPPDLAIRDEVGPTFDP
VFSLRNDKAGSVPRLLTYPGFSDYYLKQDKALLELTALDAWVLGQRERAQFSEADRREILRQVNDRYITD
YINQWQKVLANIDVQALDTPEQALDILTDITGNDQPFQRVLTTVSDNTRIRKLADDDNDTAQNINTRTGR
PFMTINAALSGRGEQGPLVQEVNQKLTDLYHYLDQIVNATDPGQAALKAMQARQGNKFADPVFALQQYAR
SLPAPLDRWVGQLAGESASLVTGLAMSSLNQEWLDKVVTPFNEKLANRYPFDPSSDKDVPLSEMEMFFMT
GGTLDSFYQTNLKAMMESGMLEEGMASPMQAELMKQLERANRIRQTLFNAQGSLEVHFVLEPLELTANKR
RSVLNLDGQLLEYSHGRRQKTPLVWPNSMRDGAESKLTLVPDDRERSPRSLSFNGPWAMFRLINSDQLTK
VNENTFDVRFSLENGAMTYRVYTDASHNPFAGGLFSQFTLSDSLY
 
Nucleotide Sequence: 3498 bp     [Download]
>gi|261819370|ref|NC_013421.1|:1173051-1176548 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGTTTAAAACAATTATAACCTTTCTACGCAAGCAGTTGCCTAAACTGAAACCCTCCTGGCTGCTTTTGG
GGGCGCTACTGTGGGTCGTGGTGTTGGTTCTGGCCTGGTGGCTGGGGCCGCGTTTGACGGTAGGCGAGTC
GCGTCCGTTACAGGGGATCTGGGGCCGCGTGGTGTTCACGCTGGTCTGGCTGTGGCTGGCGTTCTCCTAT
AGTGCCTGGCTGGTATGGCGGCGTGTGCAACTGATGCGGTCAGAGCGTCATGAGCAACAGGTGACCGAGC
AGGATCCCCTACAGGTGTATGTCGACGGCCAGCAGACGTTTCTCGATCGCTGGCTGGACGCGTTTCAGAC
CCAGTTGGGTAAAAAAGCGCTGTATGCGATGCCGTGGTATCTGACGATTGGTTTGGCTGGCAGTGGTAAA
AGTAGCCTGATCCACCGTGCCAACCCGGCAAATAAAATGAATCCGAAGCTGGATGCAGAGCTGCGGGATG
TGGCAGCAGGCCAGCAGGTGAGCAGTTGGGTCGGAGAATCTGCCGTCATCTGGGATCCTAGCGGGCAGCT
ACTCGCACAGCCTGAATTGGAAGGCGATGCGCTCGGGCAGCGTCATGCTCGGCTATGGCAGCACCTGCTA
CAGTGGCTCAGTGAGAATCGCCGCCGCCAGCCGCTTAACGGTCTGGTTCTTACGCTGGATATCTCCTGGC
TGGCACAGGCTGGTGTCGCAGATCGCAAAGCCTACGCGCAAGTCATGCGTGCCCGTTTGCAGGAAATTTC
GGTCAGCATCAATACGCGTTTACCGGTGTATATCGCACTGACTCGGCTGGATATGCTGAGCGGCTTCGAC
AAGGTCTATCGCCAGTTGAACCGCGACGCGCGTCAGGCGGTATTAGGGGTGACGTTTACCCCACAGGCGA
GCAACAGCAAAGGCTGGTTAGAAGAGCTGGAGCGTTTTTGGGATGAGTGGGTCACGCACCTGAATGACAA
CCTGCCAGACATGCTGTTGACCCAATCGGACAGAAGCGTGCGCAATTCGCTGTTCTCGTTTGTTCGCCAG
TTGGCCGGGGTGAAAGACTATGTGATGGAAGTGCTGACGGAAACGTTAGCAATAGGTGAAGATCGCGCGT
TCCTGATCCGTGGCGTCTACGTCAGCTCTGTTTATCAACAAGGGGTGCCGTTTGATGCTTTTGCACAGTC
GGCCTCCCGACGTTATCAACTGCCAGAGCCGATTAACCCCGCGTTGCGCGGTGAATCGAATACGTTTTTT
GTCCAGCGCCTCTTCCCTGACGTCATTTTCCCTGAAGCCAGCTTGGCCGGAGAAAACCGACTGCATAGCC
TCTATCGTCGGCGTCGGTTGAGTATTGGTGTGGGCTGCATGCTGCTCGCCGGTTTGGTGCTGGTGGGCAG
TTGGCACCATTTCTATCGGGTCAATGAAGAAGCCGGGCGTAACGTACTGACGAAAGCGCAGGCGTTTATC
GGCACTAATGAACTGGAAGGCCAACCGGGCTACGGCTATCAGCAGTTGCCGCGTCTGAATTTGATTCGTG
ATGCGACATTATCTTTTGGTAACTATCACGAACGCACGCCGCTGCTGGCCGATCTGGGTCTGTATCAGGG
CGATAAGATCGGGCCTTATGTCGAGGGCACCTATCTGCAAATGCTGAATCAGCGCTTTTTACCGGCGGTG
ATGCAGGGGTTGCTGGAGGATTTGAATCAGGCGCCTGCCAATAGCGAGCAAAAACTGACCATTCTGCGTG
TAATGCGCATGCTGGACGATGCTTCTGGGCGCAATAAAGCGCTGGTCGAACAGTTTATGGCGCAACGCTG
GCAAAAGGCATTTCCTGCTCAAGGTCAGGTGCAGGAAGAACTGATGCAACATCTGGATTACGCCCTCGAT
CATACCAACTGGCATCAGTCCCGTGAGCAAAAAGATGCGGTAGCGATTAGCACTTTTGCACCGTTTAATG
GGCCGATTACGCTGGCTCAGCAGGAACTAAGCAAACTGCCGATGTATCAGCGCGTTTATCAGAGTCTGGT
CATGAAGGCGACTCAAGTGCTGCCGCCGGATTTAGCGATCCGTGATGAAGTCGGGCCGACGTTTGATCCG
GTGTTTTCGCTGCGTAACGACAAAGCGGGGAGTGTGCCACGACTGCTAACCTATCCCGGCTTCAGTGATT
ATTACCTCAAGCAGGACAAAGCGCTGCTAGAGCTGACGGCATTGGATGCCTGGGTTCTGGGACAGCGTGA
ACGTGCACAGTTCAGCGAGGCCGATCGGCGGGAAATTCTGCGTCAGGTGAATGACCGCTACATTACGGAT
TACATCAACCAGTGGCAGAAAGTGTTAGCGAACATTGATGTGCAGGCGCTCGATACGCCAGAACAGGCGC
TAGATATCCTCACGGACATTACCGGTAACGATCAGCCCTTCCAGCGCGTGCTGACGACGGTCAGTGATAA
CACCCGCATTCGTAAGCTTGCCGATGATGATAACGACACGGCGCAGAACATCAATACGCGTACTGGTCGT
CCGTTTATGACCATCAATGCGGCGCTGAGTGGACGCGGTGAGCAGGGGCCGCTGGTGCAAGAGGTCAATC
AGAAACTGACCGATCTCTATCACTATCTCGACCAGATCGTTAACGCGACCGACCCGGGACAGGCGGCATT
GAAGGCGATGCAGGCACGGCAGGGAAATAAATTTGCCGATCCGGTATTTGCCTTACAGCAATATGCTCGC
AGCCTCCCTGCGCCGTTGGACCGCTGGGTAGGACAATTAGCCGGAGAGAGCGCCAGTCTGGTGACTGGGC
TCGCGATGTCATCGCTGAATCAGGAATGGCTGGATAAAGTCGTGACGCCATTCAACGAGAAGCTGGCGAA
TCGTTACCCCTTCGATCCGTCATCCGACAAAGATGTGCCGCTATCGGAAATGGAAATGTTCTTCATGACG
GGCGGGACGCTGGACAGCTTCTATCAAACCAACCTCAAAGCGATGATGGAAAGCGGCATGCTGGAAGAAG
GCATGGCGTCACCTATGCAGGCCGAGCTGATGAAACAGCTTGAACGCGCTAATCGTATCCGTCAGACCCT
GTTTAATGCGCAGGGCAGCCTGGAAGTGCATTTCGTTCTGGAACCGCTGGAATTAACGGCGAACAAGCGC
CGCAGCGTGCTGAATCTGGATGGACAGCTACTGGAATACAGCCACGGCCGTCGCCAGAAAACGCCGCTGG
TGTGGCCAAACAGTATGCGCGACGGGGCTGAAAGCAAGTTAACACTGGTGCCGGACGATCGTGAGCGCTC
GCCGCGCAGCCTGAGCTTTAACGGGCCGTGGGCCATGTTCCGGTTAATCAATAGCGATCAACTGACGAAG
GTTAATGAGAACACCTTTGACGTGCGTTTCTCGCTGGAGAATGGGGCGATGACGTATCGCGTTTATACCG
ATGCCAGCCATAACCCGTTTGCTGGTGGTCTGTTCAGCCAATTCACGTTGTCTGACTCGCTTTATTAA
 Primer design