SecReT6
Protein ID: 261821726
SecReT6 ID369
T6SS typei3
Gene symbol-
Locus tagPecwa_2464
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T6SS(s) in this replicon]
Location [Strand]2668281..2671904 [-]
Producthypothetical protein
NoteTssM
UniProt IDD0KEY6
KEGG IDpwa:Pecwa_2464
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.40E-100, Aligned region: 204..482
ImcF-related_N [PF14331], Evalue: 2.40E-100, Aligned region: 644..668
IcmF-related [PF06761], Evalue: 1.70E-80, Aligned region: 531..826
DUF1215 [PF06744], Evalue: 7.00E-31, Aligned region: 949..1074
AAA_16 [PF13191], Evalue: 0.0014, Aligned region: 139..267
AAA_16 [PF13191], Evalue: 0.0014, Aligned region: 820..915
Protein Sequence: 1207 a.a.     [Download]
>gi|261821726|ref|YP_003259832.1| hypothetical protein Pecwa_2464 [Pectobacterium wasabiae WPP163]
MLNILFAVLTSRLAWGFVGITALAFIIWVIGPVFSIADSRPLAPEHNRIISIALLYLVWGLSQAIPRLYN
FWLNRKLMSSLETGKTDAPERLTNEEQALASRFSEATGILKKAHFQRNSSKGAPFWAQRFSHQYLYQLPW
CMIIGAPGAGKTTALVNSGLQFPLADKFGKAALRGIGGTRNCDWWFTNEAVLLDTAGRYATQESQQERDA
SEWHHFLDLLRKYRGRQPINGVIVTLSVSDLLTQSPEAMRNQAIALRQRLMELHDRLGIRFPVYVLVTKT
DLLKGFRSYFGSLDKAQREQIWGFTFPWAQASTADFELNSQFQKEYSLLQQRLDAGMADTLLAERDGQSR
AEVYLFPQEFAALRPMLADALDTLFARSDFETQFAPRGIYFASGTQEGLPFDRVMGELNRALHLPSQREG
GSRRWDQVDKNAPIPPNKGQSFFLKDVLENVIFQESGLAGSNRWWELRNRAGLWSGYLALLVLILIAGGL
WVTSYSQNKSYLQEIAGKTPQVEQLGQQLQREGHGDLFALVPYLNTLLQLPKSADFSLDAPPQTRRMGLY
RGTEINDATQALYGKALKQLLLPQVAQNITRWLRNDNGSDADYSYEALKAYQMLYQPKHYDGKFLQAWLM
LNISRELPQNVTQQEVKQLAWHLQQLLETHIQSSPYAKDDALIKRGQVLINQMPLSQRVYGRLKRLLQRD
GSLKSVTLSALGGPQSELVFSRKSGKSVNDGVSGLFTPDGYWQRVDKQIAPVTQALYQDDIWVLGGITPQ
ENSQQTDLAVRQWYVQDYIRQWEQFLSDIQLNTSADLPQRINTARLLSGNHSPLRQWVINLGKLLTLTLT
RESADEKTAQAQSSSGNNATRTLEALFNSMDTNATQGQGATQQSPEQAVAVHFAPIIELAQPLQPGGNVL
AVDDFLHQIDDLYRYLTAVQDAANSGMPPPPNDAISRLQASAGRLPGSLQNMVSSMAVGASSDAQRRDMD
NVRKRITMEVGSFCRQAIAGRYPLVRNARSEVTPDDLARMFAPGSGLMDSFFRDNLASKVDTTNAAWRFT
PGIDGKTLPGGEALLRPFQQAQSIRDAFFANGATTSSFRITLRTVKMDNAILNLTLDVDGQILRYSHGPQ
AVQMVNWPGSGGTSQVRMQLGLTNGTTSTLVTSGPWALNRFFDRARLTSTGGLTREARFDVDGHQVTLSF
TPGSIRNPFQLPSFGCP
 
Nucleotide Sequence: 3624 bp     [Download]
>gi|261819370|ref|NC_013421.1|:c2671904-2668281 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGCTGAATATACTTTTTGCTGTGCTGACCAGCCGTCTCGCTTGGGGCTTTGTTGGTATTACTGCGCTCG
CCTTTATCATCTGGGTGATTGGCCCGGTGTTTTCCATTGCCGATTCACGCCCGCTTGCACCAGAGCATAA
TCGCATCATCAGTATCGCGCTGCTCTATCTGGTGTGGGGACTGAGTCAGGCGATCCCGCGCCTGTACAAC
TTCTGGCTTAACCGCAAGTTGATGTCGAGTCTGGAAACTGGCAAAACCGATGCACCGGAACGCCTGACCA
ACGAAGAGCAGGCCTTGGCGAGCCGTTTTTCTGAAGCGACGGGTATCCTGAAAAAAGCACACTTCCAGCG
CAATAGCAGTAAAGGCGCCCCGTTCTGGGCGCAGCGCTTCAGCCATCAATATCTCTATCAGTTACCGTGG
TGCATGATTATCGGTGCGCCGGGGGCGGGTAAAACCACAGCGCTGGTTAACTCGGGCCTGCAATTCCCGT
TAGCGGATAAATTTGGTAAAGCGGCGCTGCGCGGTATTGGTGGTACGCGTAACTGCGACTGGTGGTTCAC
CAACGAAGCGGTGCTGCTGGATACCGCCGGACGTTACGCCACCCAAGAGAGTCAGCAGGAGCGCGATGCC
AGCGAATGGCATCACTTCCTCGACCTGCTGCGTAAGTATCGCGGTCGCCAGCCGATTAATGGCGTGATCG
TCACGCTGAGCGTGTCGGATCTGCTGACACAATCACCGGAAGCGATGCGTAATCAGGCCATCGCGCTACG
CCAGCGCCTGATGGAGTTGCATGACCGCCTCGGCATTCGCTTCCCGGTGTATGTGCTGGTGACCAAAACC
GACCTGCTCAAAGGTTTCCGCAGCTACTTCGGTTCGCTGGATAAAGCGCAACGCGAACAGATCTGGGGGT
TCACCTTCCCGTGGGCACAGGCCTCCACCGCTGACTTCGAACTCAACAGCCAGTTCCAAAAGGAATATTC
GCTGCTACAACAGCGTCTTGATGCTGGCATGGCCGATACGTTGCTGGCAGAGAGAGATGGACAGTCGCGC
GCAGAGGTCTATCTGTTCCCGCAGGAGTTTGCCGCGTTGCGCCCAATGCTAGCGGATGCGCTTGACACGT
TGTTCGCGCGTTCGGATTTTGAAACCCAGTTCGCACCACGTGGCATCTATTTTGCCAGCGGTACACAGGA
AGGTCTGCCGTTTGACCGTGTGATGGGGGAGTTGAACCGTGCTCTGCATCTGCCGAGCCAGCGAGAAGGT
GGATCCAGACGCTGGGATCAGGTGGATAAAAACGCGCCGATCCCACCGAATAAAGGGCAAAGCTTCTTCC
TGAAAGACGTACTGGAAAACGTTATCTTTCAGGAATCGGGGCTTGCGGGTAGCAACCGTTGGTGGGAACT
GCGTAACCGTGCTGGTTTGTGGTCTGGCTATCTGGCATTGCTGGTGCTGATACTGATTGCCGGGGGGCTG
TGGGTTACCAGCTACAGTCAAAATAAATCTTACCTGCAGGAAATCGCGGGCAAAACGCCGCAGGTTGAGC
AACTCGGCCAGCAACTACAGCGTGAAGGCCACGGTGACTTGTTCGCTCTGGTGCCGTATCTCAATACCCT
GCTGCAGTTGCCTAAAAGCGCTGATTTCTCACTGGACGCGCCGCCGCAGACGCGCCGTATGGGGCTCTAT
CGCGGGACTGAAATCAACGATGCCACTCAGGCGTTGTATGGCAAAGCGCTAAAACAGTTGCTGTTGCCGC
AGGTGGCGCAAAATATTACGCGCTGGTTGCGCAACGACAACGGCAGCGATGCCGACTACAGCTACGAAGC
GCTAAAGGCGTATCAGATGCTGTATCAGCCGAAGCACTACGACGGTAAATTCCTGCAGGCATGGCTGATG
CTAAATATCTCGCGCGAACTGCCGCAGAACGTCACTCAGCAGGAAGTTAAACAACTGGCGTGGCATCTAC
AACAACTGCTGGAGACGCACATCCAGTCTTCGCCATACGCGAAGGATGATGCGTTGATAAAGCGCGGGCA
GGTGCTGATTAACCAAATGCCGCTGTCACAACGCGTCTATGGGCGTCTGAAGCGCCTGCTGCAACGCGAT
GGCAGCCTGAAATCGGTGACGCTCTCGGCGCTGGGCGGGCCACAGAGTGAACTGGTGTTCTCACGTAAAA
GTGGTAAGTCGGTTAATGATGGTGTGTCAGGCCTGTTTACACCGGATGGTTACTGGCAGCGCGTTGATAA
GCAAATTGCGCCAGTGACGCAGGCACTGTATCAGGATGATATCTGGGTGTTGGGCGGCATCACGCCGCAG
GAAAACAGCCAACAAACCGATCTCGCAGTACGCCAATGGTATGTACAGGATTACATTCGTCAGTGGGAAC
AGTTCCTTAGCGATATCCAACTCAACACTAGTGCTGATTTACCGCAGCGCATCAACACCGCGCGTTTGCT
GTCCGGCAACCATTCACCGTTACGCCAATGGGTGATCAATCTGGGAAAATTGCTGACGCTGACGCTGACG
CGCGAGTCGGCGGATGAAAAAACGGCACAGGCGCAATCGTCATCCGGCAACAACGCGACGCGCACGCTGG
AAGCGCTGTTCAACTCGATGGATACTAATGCAACGCAGGGGCAGGGGGCGACGCAGCAGTCACCGGAGCA
GGCCGTTGCCGTGCATTTCGCCCCGATTATCGAGTTGGCGCAGCCGTTACAGCCGGGCGGTAACGTGCTG
GCGGTGGACGATTTTCTACATCAGATTGACGATCTCTATCGTTATCTCACCGCGGTGCAGGATGCGGCCA
ACAGCGGCATGCCGCCACCACCGAACGATGCCATCAGCCGCCTGCAGGCCAGTGCTGGCCGTCTGCCGGG
TTCGCTGCAGAATATGGTCTCCAGTATGGCGGTTGGTGCCAGCAGCGATGCACAACGCCGTGACATGGAT
AACGTGCGCAAGCGCATCACCATGGAAGTTGGCAGCTTCTGTCGTCAGGCGATCGCCGGTCGTTATCCAC
TGGTACGCAACGCACGCAGTGAAGTGACGCCAGACGATCTGGCGCGCATGTTCGCACCGGGCAGCGGCCT
GATGGATAGCTTCTTCCGTGACAATCTGGCCAGCAAAGTAGACACCACTAACGCCGCGTGGCGCTTTACG
CCGGGTATCGACGGTAAAACGTTGCCGGGGGGCGAAGCACTGCTGCGTCCGTTCCAGCAGGCGCAGTCGA
TTCGTGATGCCTTCTTTGCCAACGGAGCCACCACATCATCGTTCCGCATCACGCTGCGCACGGTGAAAAT
GGATAACGCGATCCTCAACCTGACGCTGGATGTTGACGGTCAGATTCTGCGTTACAGCCACGGCCCGCAG
GCGGTGCAGATGGTGAACTGGCCCGGTTCAGGCGGCACCAGCCAGGTGCGCATGCAGCTCGGCCTGACTA
ATGGCACTACCTCGACGCTGGTCACCAGCGGCCCGTGGGCGCTTAATCGCTTCTTCGATCGCGCCCGGCT
GACCTCAACCGGCGGTTTAACCCGCGAAGCCCGTTTCGACGTCGATGGTCATCAGGTCACGCTATCGTTC
ACGCCTGGCAGTATTCGCAACCCATTCCAGCTTCCCAGCTTTGGCTGCCCCTGA
 Primer design