SecReT6
Protein ID: 262192894
SecReT6 ID192
T6SS typei3
Gene symbol-
Locus tagBMA10247_A2018
StrainBurkholderia mallei NCTC 10247
Repliconchromosome II [GenBank: NC_009079] [Browse all T6SS(s) in this replicon]
Location [Strand]1951305..1951853 [-]
Producttype VI secretion protein
NoteTssB
UniProt IDD0IUR4
KEGG IDbmn:BMA10247_A2018
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.30E-54, Aligned region: 11..159
Protein Sequence: 182 a.a.     [Download]
>gi|262192894|ref|YP_003276038.1| type VI secretion protein [Burkholderia mallei NCTC 10247]
MVRQKDGQKFIGESRAPRVQIEYDVEVYGSQKKVELPFVAGVMADLSGDNVEPLGPVEDRRFQEIDVENF
DERMAQIAPSLSYHVKNVLTNDGTLIPIDLTFTSMESFEPADVVKRIPELSTLLEARNRLKELLTYMDGK
AAAEDVIQELLKSPQWANEADAAEQSGGAGEGGDHQPEEGAK
 
Nucleotide Sequence: 549 bp     [Download]
>gi|126445587|ref|NC_009079.1|:c1951853-1951305 Burkholderia mallei NCTC 10247 chromosome II, complete sequence
ATGGTTCGACAAAAGGATGGACAGAAATTCATCGGGGAGAGTCGTGCGCCCCGCGTGCAGATTGAATACG
ACGTGGAGGTGTACGGCTCGCAGAAGAAGGTCGAGCTGCCGTTCGTCGCGGGCGTGATGGCGGACCTGTC
GGGCGACAACGTCGAGCCGCTCGGCCCGGTCGAGGATCGGCGCTTTCAGGAGATCGACGTCGAGAACTTC
GATGAGCGCATGGCGCAGATCGCGCCGTCGCTGAGCTATCACGTGAAGAACGTGCTGACCAACGACGGCA
CGCTGATTCCGATCGATCTGACGTTCACGTCGATGGAATCGTTCGAGCCGGCGGACGTCGTCAAGCGCAT
TCCCGAGCTGTCGACGCTGCTCGAGGCGCGCAACCGGCTGAAGGAGCTGCTGACCTACATGGACGGCAAG
GCGGCAGCCGAGGACGTGATCCAGGAATTGTTGAAGAGCCCGCAGTGGGCGAACGAGGCCGACGCGGCGG
AGCAATCCGGCGGCGCCGGCGAGGGTGGAGACCATCAACCGGAAGAGGGTGCGAAATGA
 Primer design