SecReT6
Protein ID: 262395315
SecReT6 ID370
T6SS typei5
Gene symbol-
Locus tagVEA_000016
StrainVibrio sp. Ex25
Repliconchromosome II [GenBank: NC_013457] [Browse all T6SS(s) in this replicon]
Location [Strand]13497..17015 [+]
ProductIcmF-related protein
NoteTssM
UniProt IDD0MCI9
KEGG IDvex:VEA_000016
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.90E-87, Aligned region: 79..106
ImcF-related_N [PF14331], Evalue: 1.90E-87, Aligned region: 190..452
IcmF-related [PF06761], Evalue: 5.00E-86, Aligned region: 502..805
DUF1215 [PF06744], Evalue: 1.20E-38, Aligned region: 916..1034
AAA_19 [PF13245], Evalue: 0.0052, Aligned region: 127..141
Protein Sequence: 1172 a.a.     [Download]
>gi|262395315|ref|YP_003287168.1| IcmF-related protein [Vibrio sp. Ex25]
MRIKEIGRIFTQRWFLGLIGVAACSIFIWVVGPLITIAGYEPLKSDFQRLVTILVLVFVWALFNVTKQHK
QKVKEDESIQTLLEVDSQSDKEAASEIDLMRERIEQAVKVVTKTHKGKRSLYDLPWYVLIGPPGTGKTTV
LKQSGLEFPLADSLGSDSIAGVGGTRHCDWWFANKAVLIDTAGRYTTQDSQEKVDSKAWHGFLGLLKKYR
TQRPINGAIVTISLASVMSQTRTERSLHARAIKSRLQELKNQLGMQFPIYVLLTKMDLVAGFNEFFSDLS
KEEREELFGFMFPREVADERGVISLFNKEFHGMLERLDARMLRILETEDDLEKRALIFEFPKQLRVLQAN
LDEFLAEIFAQNSFEEPALIRGVFMLSSVQEGLPVDKLMNESTNGLGLNRLALAKSPTGSHSYFVKNLFD
KVIFKEQLLGTVNRHYQKQSGWMRRGVYIGCASLLLGASALWLMSYKWNSQLIVDTNEQAGHIEAMIGAE
SLDFEADIISAVETLDRLMTLPLGKQSNYGDADSVKRFGLYQGDKVSQAANNAYSDALTQYYAPLLLDSL
VTEMESNQQHREYLYETLKTYLMLFNPDKYQQDEVLAWFNFYFERQYPGELNLDLRKGLLQHTQNLLENN
GQGFSYNTAAVTNAREVLTQMSLPERAYQRMKIQFSKSHVPSFRLTDVLGPKGLEQFERASGKPLSQGIS
GFYTYNGFHSIFQIQINRTVKSLMEENWVYGDDLKAHEIDQDSAIQGVQSRYYQDYVNEWKTLIEDIQLK
QAPSLELATEQARVLSGVERPIESLLRAIQKEVGLSKVSLSENQKATSEVAGKVAKVKFSNTADRLDMYL
PEENGFNVALPGKEVESHFSEILRLGEQDFDDIQQAMVNLRSYLSDLSSSGNNQKIAYKSILDGTVTQDV
AASFARAKELLPRPFNQWLGELSQESVKFAESGSKDHLNQLWVTQVVRPYQRTIAGRYPFEPNASREVRL
KDFKRFFGYGGTLDSFFQEYLEPFVDTSKSRWRLEKEIGVRPETLMVFQRAKRIRQSFFESDNSLRVEFG
MKPVYLDQHITRFVLELGKQDLVYKHGPARAKSLSWPAGQDQTRIVFTPPESKREIAHTYEGEWGIFKLL
DQSLKARPESRKDNIVMIDLKGNKVQLELIPSSAINPFWSNEMERFRCPRTL
 
Nucleotide Sequence: 3519 bp     [Download]
>gi|262395299|ref|NC_013457.1|:13497-17015 Vibrio sp. Ex25 chromosome 2, complete genome
ATGCGTATTAAAGAAATTGGCAGAATATTTACTCAAAGGTGGTTTCTCGGTCTTATCGGTGTCGCTGCTT
GTTCAATTTTTATTTGGGTTGTTGGTCCACTTATCACGATAGCGGGATATGAGCCGCTAAAGAGCGACTT
CCAACGACTCGTCACGATTTTGGTGCTGGTGTTTGTGTGGGCTTTATTCAACGTGACTAAGCAGCACAAG
CAAAAAGTTAAAGAAGACGAAAGTATTCAAACGTTACTTGAGGTTGATAGTCAGTCAGATAAAGAAGCGG
CGAGTGAAATTGACTTAATGCGCGAGCGTATTGAGCAAGCTGTCAAAGTAGTAACGAAAACACATAAAGG
AAAGCGAAGCTTATATGACTTGCCTTGGTATGTGTTGATCGGCCCTCCAGGGACAGGAAAAACAACAGTG
TTAAAGCAGTCAGGGCTGGAGTTTCCGTTAGCGGATAGCCTTGGTTCTGACTCTATTGCTGGTGTCGGTG
GAACTCGTCATTGTGATTGGTGGTTTGCAAATAAAGCCGTTCTGATTGATACGGCCGGTCGATACACGAC
ACAAGACAGTCAAGAAAAGGTCGACTCTAAAGCATGGCACGGCTTCTTAGGGTTGTTGAAAAAATATAGA
ACGCAAAGGCCAATTAATGGTGCAATTGTCACGATCAGTTTAGCCAGTGTGATGTCGCAGACAAGAACCG
AGCGAAGCCTTCATGCCCGAGCTATCAAGTCGCGCCTTCAAGAACTGAAGAATCAGTTAGGGATGCAATT
TCCTATTTACGTACTACTGACCAAAATGGATTTAGTTGCGGGTTTCAATGAGTTCTTCTCTGATCTAAGT
AAGGAAGAGCGTGAGGAATTGTTCGGTTTCATGTTTCCGCGTGAAGTGGCTGATGAAAGAGGGGTTATTT
CTTTATTCAATAAAGAATTTCATGGCATGTTGGAGCGCCTTGATGCGCGAATGCTGAGAATCCTTGAAAC
TGAAGATGATTTAGAGAAGCGAGCACTTATTTTTGAATTTCCTAAACAGCTAAGGGTATTGCAAGCTAAC
CTTGATGAATTTTTAGCGGAAATATTTGCACAAAATAGTTTTGAAGAGCCAGCCTTGATTCGTGGTGTGT
TTATGTTGAGCTCGGTCCAAGAAGGCTTACCAGTCGATAAGTTAATGAATGAATCGACCAATGGACTTGG
ACTAAATCGCCTCGCTCTAGCAAAAAGCCCAACAGGATCTCATAGTTATTTCGTGAAGAACTTGTTTGAT
AAGGTTATTTTCAAGGAACAACTGTTAGGAACGGTTAATCGTCACTATCAAAAGCAGTCAGGGTGGATGC
GCCGAGGTGTTTACATTGGCTGTGCTTCTCTACTGCTAGGTGCGTCTGCACTTTGGCTTATGAGCTACAA
GTGGAATTCTCAGTTGATTGTCGATACCAATGAGCAAGCCGGCCATATTGAAGCAATGATTGGTGCTGAG
AGCTTAGATTTTGAGGCGGATATTATCTCAGCCGTAGAGACATTAGACCGATTGATGACGCTTCCTCTAG
GAAAGCAAAGCAACTACGGCGATGCTGATTCCGTAAAAAGGTTTGGTCTCTATCAAGGAGATAAAGTCTC
ACAGGCGGCGAACAATGCATATTCTGATGCGTTGACCCAATATTACGCTCCCTTGCTTCTTGATAGCTTG
GTGACGGAAATGGAAAGTAATCAACAGCATCGAGAGTATTTGTATGAAACGTTGAAAACTTATTTGATGT
TATTTAATCCAGACAAATACCAACAAGATGAAGTGTTGGCTTGGTTTAACTTCTATTTTGAACGTCAATA
TCCGGGTGAACTAAATCTAGACTTAAGAAAAGGTCTGTTACAGCACACTCAAAATTTATTAGAGAATAAT
GGACAAGGCTTTTCTTATAATACTGCTGCCGTGACTAATGCTCGCGAGGTTTTGACACAAATGTCTCTAC
CAGAACGTGCTTATCAGCGAATGAAGATACAATTTTCGAAGAGTCATGTTCCTTCATTTCGTTTGACTGA
TGTCTTGGGGCCTAAAGGGCTTGAGCAGTTTGAACGAGCGAGTGGAAAGCCGTTATCACAAGGCATTTCG
GGCTTTTATACGTACAATGGCTTTCATAGCATTTTTCAGATTCAGATCAACCGTACAGTAAAAAGCCTAA
TGGAAGAGAACTGGGTTTATGGTGACGATCTTAAGGCTCATGAAATTGATCAAGATAGCGCTATTCAAGG
AGTCCAATCTCGATACTATCAAGATTATGTGAATGAATGGAAAACTCTGATCGAAGATATTCAACTTAAG
CAGGCTCCGAGCCTAGAGCTTGCAACAGAACAAGCTAGAGTTCTATCTGGAGTTGAAAGACCAATCGAAT
CGTTGTTGAGGGCAATCCAAAAAGAAGTTGGTTTGTCGAAAGTATCATTGTCAGAAAATCAGAAGGCCAC
TTCTGAAGTCGCTGGTAAGGTTGCCAAAGTTAAATTTTCGAATACGGCAGATAGACTAGACATGTACTTG
CCTGAAGAAAATGGTTTCAATGTTGCACTGCCAGGTAAAGAAGTCGAATCTCATTTTTCGGAGATCTTAC
GTCTCGGCGAACAAGACTTTGATGATATTCAACAAGCTATGGTTAACTTGCGCTCGTATTTAAGCGATTT
ATCAAGCTCAGGTAATAATCAGAAAATTGCTTACAAAAGTATTTTAGATGGGACCGTTACACAAGATGTA
GCAGCTTCCTTTGCTCGCGCTAAAGAACTTTTGCCTAGGCCATTTAATCAATGGCTAGGTGAACTTTCTC
AAGAGTCAGTTAAGTTTGCGGAGAGCGGGTCGAAAGATCATCTAAATCAGCTTTGGGTTACGCAAGTGGT
GCGCCCTTATCAGCGGACTATTGCGGGTAGATACCCATTCGAGCCAAATGCAAGCAGAGAAGTAAGGCTG
AAGGACTTCAAACGTTTCTTTGGTTATGGAGGTACGCTTGACTCATTCTTCCAAGAGTATCTTGAACCGT
TTGTCGATACTTCGAAAAGTCGTTGGCGATTAGAAAAGGAAATTGGAGTTCGTCCAGAAACGCTGATGGT
CTTTCAAAGAGCGAAGCGTATCAGGCAGTCTTTCTTTGAATCTGATAATTCATTGCGCGTAGAGTTCGGT
ATGAAACCAGTGTATCTGGATCAGCACATTACTCGGTTTGTTCTAGAGCTAGGTAAGCAAGATTTGGTTT
ATAAGCATGGACCAGCACGAGCTAAATCCTTGAGCTGGCCTGCGGGTCAAGACCAGACTCGAATAGTGTT
CACACCGCCAGAATCTAAACGTGAGATTGCCCATACTTATGAAGGTGAGTGGGGCATATTCAAACTGCTA
GATCAATCACTTAAAGCAAGACCAGAATCACGTAAAGACAACATAGTTATGATTGATTTAAAGGGAAATA
AGGTGCAACTAGAGCTTATTCCGTCTAGTGCTATTAATCCGTTTTGGTCAAATGAAATGGAGAGGTTCAG
ATGTCCGCGAACCTTGTAA
 Primer design