SecReT6
Protein ID: 262395735
SecReT6 ID371
T6SS typei1
Gene symbol-
Locus tagVEA_000435
StrainVibrio sp. Ex25
Repliconchromosome II [GenBank: NC_013457] [Browse all T6SS(s) in this replicon]
Location [Strand]494736..498128 [+]
ProductIcmF-related protein
NoteTssM
UniProt IDA7JYG6
KEGG IDvex:VEA_000435
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.60E-53, Aligned region: 154..408
IcmF-related [PF06761], Evalue: 9.20E-49, Aligned region: 494..755
DUF1215 [PF06744], Evalue: 3.20E-31, Aligned region: 866..987
DUF4131 [PF13567], Evalue: 0.0055, Aligned region: 16..68
DUF4131 [PF13567], Evalue: 0.0055, Aligned region: 396..437
Protein Sequence: 1130 a.a.     [Download]
>gi|262395735|ref|YP_003287588.1| IcmF-related protein [Vibrio sp. Ex25]
MFKQKLFRNPVVISTILTLLVAITITAIYLLFLKDADRLYLWLSLSVIAIFYVTFQFTLWLKKKNSAKAQ
NLETEEEALSMVIQPLLANSGKKPIYLMLGNKGSGRRQFLFNSSAIKPMDRTRTAKNDFFEWYESDSAVY
IKPDQRLVFQEISSSDASLWNTFIEEVIRHRPRKPFSGCLFFIDFEFMIVSEPEQKEYTISSLLERLSTI
NSKTSSALPIYLIMSKLDKLDGFKEYMHFSSLKTRVEFLSIPLKEAKGVFSEYYRDSYRNLVKVLESNAL
DASANSTDIDEKQAILAFPKQFELCQSEVSYVLERLCDVNNGVYSLDIREIFFSSSLQGGRKYNLLAKSC
SNYFNLPIIASEHTQLTETPYFSRFLIDSQILPESDFAGENKTYLRLIQRQSRLAILGSIILLAGGGYFF
ATTLDSNLHVMNQLLSIDDKSQAEHDARFSELLENATKAIEPSYGAWLKGSKALDEEILPLNISRLDQST
RIAYEALLKEVAQQLIPLIEKGYRLQLAQNQNAFTRALPLLKGYLMLNDPSKRDIRFLRHQTLQMMSDLS
NRSDVVDQAMRYLDAYFRTQFAPIDINMDLVRATRRSLLANSNVDLVYAGILNEASSIDLGTLDLQRAVG
FEFSNVFNTPIDSERLIVDKIYTSTGFSTFYRPRVDLMSQRVISDNWVLGLSQHVIPTNEEQEAFKEEVR
KKYTDDYINNWRNALSELKVQNYDNVGDLTNAIDLISGPSSPMTTVLKQVYANTQFSPVGEKSALISKLD
PKLAAAADSASDAVEEVVKPDYLLMQRVEQAFHLLNQLQVSETPNSPTPWDETVAALSRVRTYMKDIADA
PDPQMAALAAAQHRMNSTEADPLIKLKQIAQKSPEPVRSWLLDVVQQSWSVMITESAKGIQTQWYSEIYT
KFKEIGLGKYPFDLTATEEISIEDFELLFASGGLLDTFIQKNFAPFYDTNLWTPKQVDGETMPISPALLV
QLRNYNVIRDTLINKSTNRVHIPFSARVLDLDSSAIRASLKIADTNMSYYHGPSRIREMAWPPQNGDFNI
SITLQDVTDEGRQHVLNKSGQWAIYRLLGDSTLTNTHNGSFVSDIKVSGRDLSLRITPLTQKNPFTLAEL
YNFTLPESIK
 
Nucleotide Sequence: 3393 bp     [Download]
>gi|262395299|ref|NC_013457.1|:494736-498128 Vibrio sp. Ex25 chromosome 2, complete genome
ATGTTCAAACAAAAACTGTTTAGAAATCCAGTTGTGATTTCTACTATATTAACGCTTTTAGTGGCGATAA
CCATTACCGCTATTTATCTTCTTTTTCTAAAAGATGCAGATAGACTGTATCTTTGGCTGAGCCTTAGTGT
TATCGCCATTTTCTACGTCACTTTTCAATTCACACTATGGTTGAAAAAAAAGAACAGCGCTAAAGCTCAA
AATTTGGAAACTGAGGAAGAAGCTCTTTCTATGGTTATCCAACCTCTTCTTGCTAACTCAGGCAAGAAAC
CAATTTATCTGATGCTTGGTAATAAAGGGTCAGGGCGACGTCAATTTTTATTTAATTCTAGTGCAATTAA
ACCAATGGATCGCACGAGAACCGCTAAGAATGATTTTTTTGAATGGTACGAATCTGACAGCGCTGTATAC
ATCAAACCTGACCAACGCTTAGTGTTTCAAGAAATATCAAGCAGTGATGCTTCTTTATGGAATACATTCA
TCGAAGAAGTGATTCGCCACCGACCTAGAAAACCATTTTCTGGCTGTTTATTCTTTATCGACTTCGAGTT
CATGATCGTCTCTGAGCCAGAACAAAAAGAGTACACTATTTCGTCGTTATTGGAGCGCTTGAGCACTATC
AACTCTAAAACGTCGTCAGCATTACCCATTTATCTAATTATGTCGAAGCTAGACAAGTTAGATGGATTTA
AAGAATACATGCACTTTAGCTCTCTTAAGACACGTGTAGAGTTCCTTTCTATCCCACTGAAAGAGGCCAA
AGGTGTTTTTTCAGAATACTATCGTGATAGTTACCGAAATCTAGTTAAAGTGCTTGAAAGTAACGCGCTA
GATGCATCAGCTAACTCAACAGATATCGACGAGAAACAGGCAATTCTCGCTTTCCCTAAGCAGTTTGAGC
TATGTCAGTCTGAAGTCAGCTATGTTCTAGAGCGTCTGTGTGATGTTAACAACGGTGTTTATTCGCTAGA
TATCCGTGAAATTTTCTTTAGCTCAAGTTTACAAGGCGGTCGTAAATACAATTTACTAGCAAAAAGTTGT
AGTAACTACTTCAACTTACCAATTATCGCCTCTGAGCATACCCAGTTGACGGAAACACCGTATTTTTCTC
GCTTTCTGATTGATTCGCAAATATTGCCTGAAAGCGATTTTGCGGGAGAAAACAAGACGTATCTTCGTCT
AATTCAGAGACAAAGCCGTTTAGCCATACTCGGCTCCATTATTCTGCTTGCTGGCGGTGGTTACTTTTTT
GCAACTACGTTAGACAGTAATTTACATGTGATGAATCAACTACTAAGTATTGATGACAAATCACAAGCAG
AGCACGATGCAAGATTTAGTGAGCTTTTAGAAAATGCAACCAAAGCGATAGAACCGTCTTATGGGGCATG
GCTTAAAGGTTCTAAGGCTTTAGATGAGGAAATATTACCACTCAATATTAGCCGTTTGGATCAAAGCACT
CGCATTGCCTACGAAGCGTTACTTAAGGAAGTCGCTCAGCAGCTAATACCTCTGATTGAGAAAGGTTACC
GCCTACAATTGGCACAAAATCAAAACGCTTTCACGCGCGCTTTACCTCTATTGAAGGGGTATTTAATGCT
TAACGATCCATCTAAGCGTGATATCCGTTTTTTACGTCATCAAACACTCCAAATGATGAGTGATTTGAGT
AACCGAAGTGACGTCGTTGATCAGGCCATGCGCTACTTAGACGCCTACTTTCGCACACAATTTGCTCCAA
TCGATATCAACATGGATCTTGTTCGTGCAACACGTCGCTCATTACTTGCAAATTCGAATGTCGACCTCGT
GTATGCAGGCATTTTAAACGAAGCAAGCTCTATTGATTTAGGAACATTAGATCTGCAACGAGCCGTCGGT
TTTGAGTTTAGCAATGTATTTAATACGCCAATCGATAGCGAACGCTTAATCGTCGATAAGATCTATACCT
CCACTGGTTTTAGCACCTTTTATCGACCACGCGTGGACTTAATGTCACAACGAGTAATCAGCGACAACTG
GGTTCTAGGTCTATCGCAACATGTCATCCCTACCAACGAAGAGCAAGAAGCCTTTAAAGAAGAAGTGCGA
AAAAAATATACTGATGACTACATCAATAACTGGCGTAATGCGCTGAGTGAGCTCAAAGTCCAAAACTATG
ACAACGTTGGTGACCTGACCAACGCGATAGACTTAATCTCTGGCCCTTCTTCACCAATGACAACGGTATT
GAAGCAGGTCTATGCCAACACACAATTTTCACCCGTTGGCGAAAAAAGCGCTCTAATTTCAAAACTTGAC
CCGAAACTCGCGGCAGCAGCAGATTCGGCATCAGATGCTGTAGAAGAAGTGGTAAAGCCTGATTACTTGC
TAATGCAACGTGTTGAGCAAGCCTTTCACTTATTAAACCAGCTTCAAGTGAGTGAGACACCAAACTCCCC
TACTCCTTGGGATGAGACCGTTGCAGCGTTGAGCCGTGTTCGCACCTACATGAAGGACATCGCCGACGCG
CCAGATCCACAAATGGCGGCGCTAGCAGCAGCACAGCATCGAATGAACAGTACTGAGGCGGACCCATTAA
TCAAGCTTAAACAGATTGCACAAAAATCACCAGAACCCGTTCGCAGCTGGTTACTAGATGTGGTTCAGCA
AAGCTGGTCAGTAATGATTACAGAGTCCGCAAAAGGCATCCAAACTCAGTGGTACAGTGAAATTTATACC
AAGTTTAAAGAGATTGGATTGGGGAAATATCCATTTGACCTAACAGCGACCGAGGAAATCTCAATTGAAG
ATTTCGAATTGCTATTTGCTTCAGGTGGTTTGTTAGACACATTTATTCAGAAAAACTTTGCACCGTTCTA
CGATACGAACTTGTGGACGCCAAAGCAGGTAGATGGTGAGACGATGCCAATCTCTCCAGCTCTGCTAGTG
CAACTACGCAACTATAATGTCATTCGAGATACATTAATTAATAAAAGCACCAACCGAGTTCATATTCCGT
TTAGTGCAAGAGTACTCGACCTTGACTCTAGTGCAATTAGAGCCAGTTTAAAAATTGCGGATACCAATAT
GAGTTACTACCACGGTCCAAGCCGAATTCGTGAAATGGCCTGGCCACCGCAAAATGGTGACTTCAATATT
AGTATCACACTCCAGGATGTAACAGACGAAGGTAGACAGCACGTTTTAAACAAGAGTGGTCAATGGGCGA
TATACAGATTGCTAGGTGACTCGACCTTGACAAACACTCATAACGGCAGCTTTGTCAGTGACATAAAAGT
GTCAGGGAGGGACTTAAGCTTACGCATCACTCCATTGACGCAGAAAAACCCATTCACTCTTGCTGAGCTA
TATAACTTTACGCTCCCAGAGTCGATTAAATAA
 Primer design