SecReT6
Protein ID: 26249233
SecReT6 ID37
T6SS typei2
Gene symbol-
Locus tagc3398
StrainEscherichia coli CFT073
Repliconchromosome [GenBank: NC_004431] [Browse all T6SS(s) in this replicon]
Location [Strand]3239189..3242527 [+]
Producthypothetical protein
NoteTssM
UniProt IDQ8FEC7
KEGG IDecc:c3398
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 3.90E-66, Aligned region: 396..714
IcmF-related [PF06761], Evalue: 3.90E-66, Aligned region: 776..815
DUF1215 [PF06744], Evalue: 1.00E-34, Aligned region: 430..463
DUF1215 [PF06744], Evalue: 1.00E-34, Aligned region: 835..954
DUF4131 [PF13567], Evalue: 0.0084, Aligned region: 8..81
Protein Sequence: 1112 a.a.     [Download]
>gi|26249233|ref|NP_755273.1| hypothetical protein c3398 [Escherichia coli CFT073]
MKRVVRLLGVGLLLLVVLLLILFVLAQTTPLISAQDEHAVWLRLLITAIVICLLSMCIFFLFSFRQNEAS
TISLYAQPTDIKEINTEQPNYASLLTIYLRDRYGPFWRRKVRLLLVTGEPEQAEAIAPGLTGQHWLEGDH
TVLIYGGRPTAEPDVTLLTALKKLRRSRPLDGIIWALTEEQSRQTAQLDKGWRGLINGGKRLGFQAPLYL
WQVCDDGDYQTGRPLQSVGCLLPERCTPEQLAVMLEAQTLPLTEQGMSQLLTDNRHDFLLRLAHTLAERG
IAHWQTVLKPLLAGGAFSSLRLRGLMFSPPLAAVPEAAPHAWLPSPVWAGVTGDNARGRTVGFPWLRTAL
MSAVCVLVIWGAGMTTSFFANRALVQETGIQTARALDTRLPLAEQLVALHTLQGELERLQYRIREGAPWY
QRFGLERNQQLLAAAFPGYAQAANRLVRDVAVDHLQQQLNAFVALPPNSPQRTATGEQRYKQLKALLMTS
RPEKADAAFFSTTLMADGLRYENIPEGVRQSVLPSLLTFWTANLPEHPQWKTSPPPELTGAVRKILLRQI
GVRNAENTLYQNVLQQVSRNYADMTLADMTGDTLTESLFSTEQTVPGMFTRQAWEGQVREAIEQVVTARR
EEIDWVLSDRQQDTSADISPDTLRNRLTSRYFTDFAGSWLAFLNSIHWKKEDSLSGILDQLTLMADARQS
PLIALTDTLAWQAATGRENRGLSDSLAKSAQELFNGKEKTPQQSREGDDVPVGPLDKTFTPLLRLLGDKA
GGGDSQLSLQTYLTRVTRVRLKLQQVTNAPDPQEMTQQLAQTVLQGKTVDLTDTRDYGRLIAASLGEEWS
GFGQALFVRPVEQSWRQVLTPAADSLNRQWQRAIVSHWNQDFAGRYPFKASQNDASLPLLAQYLRDDGRI
NLFIAANLSGVLKREGRYWVADAMNTQGLTVNPDFIRALNRLRDVADTAFASGDAGIHFELRAKPARDVM
KTHLVIDGQELEYFNQKERWQRFNWPDEQWQPGASLSWTSTQAMERILADYRGSWSLIRLLEQAQVTPVD
SSTFKVVWKAQDGLPLNYLLRVEQGKGPLALLELKNFRLPGQVFLTGKSMKDVEEYGEDADE
 
Nucleotide Sequence: 3339 bp     [Download]
>gi|26245917|ref|NC_004431.1|:3239189-3242527 Escherichia coli CFT073 chromosome, complete genome
ATGAAAAGAGTTGTGCGTCTTTTGGGTGTGGGGTTACTGCTCCTTGTTGTGTTGTTGCTCATTTTGTTTG
TTCTGGCTCAGACCACACCGCTGATATCAGCACAGGATGAGCATGCTGTCTGGCTTCGTCTGTTGATAAC
AGCGATTGTGATCTGTTTGCTAAGTATGTGCATATTTTTCCTCTTTTCTTTCCGGCAGAACGAAGCCTCG
ACGATATCACTATACGCTCAACCGACTGATATAAAGGAAATAAATACGGAGCAGCCGAACTATGCATCAC
TGCTGACGATATATTTACGCGACCGCTACGGTCCGTTCTGGCGGCGTAAAGTCCGCCTGCTGCTGGTGAC
CGGCGAGCCTGAACAGGCAGAAGCCATCGCGCCGGGGCTGACCGGGCAACACTGGCTGGAAGGCGACCAC
ACGGTGCTGATATATGGCGGCAGGCCAACAGCGGAGCCTGATGTCACACTGCTGACCGCCTTAAAAAAAC
TGCGCCGCAGCCGTCCGCTGGACGGCATCATCTGGGCGCTGACAGAAGAACAGAGCCGCCAGACAGCGCA
ACTCGACAAAGGCTGGCGCGGACTGATAAACGGCGGTAAGCGACTCGGTTTTCAGGCTCCACTCTATTTG
TGGCAGGTCTGTGACGACGGTGATTATCAGACCGGACGCCCCCTGCAAAGCGTCGGCTGCCTGCTGCCGG
AACGCTGTACCCCGGAACAACTGGCTGTAATGCTGGAAGCACAAACCCTGCCGCTGACGGAACAGGGCAT
GTCGCAGCTACTGACCGATAACCGCCATGATTTTCTGCTGCGTCTGGCTCATACCCTTGCAGAGCGGGGT
ATTGCTCACTGGCAGACCGTCCTGAAACCGCTGCTGGCAGGCGGCGCATTTTCTTCCCTGCGCCTGCGCG
GCCTGATGTTCAGCCCGCCGCTTGCCGCCGTGCCGGAGGCCGCACCTCATGCGTGGCTGCCGTCACCGGT
CTGGGCGGGCGTGACGGGTGATAACGCGCGCGGGCGCACGGTGGGTTTTCCGTGGCTGCGTACCGCACTG
ATGTCCGCTGTCTGCGTGCTGGTGATATGGGGGGCCGGAATGACGACCTCGTTCTTCGCCAACCGCGCTC
TTGTTCAGGAAACCGGTATCCAGACGGCACGTGCGCTTGATACCCGCCTGCCGCTGGCAGAACAACTGGT
GGCGCTGCATACCCTGCAGGGCGAACTGGAACGCCTGCAATATCGTATCCGCGAAGGTGCGCCGTGGTAT
CAGCGTTTTGGCCTTGAACGTAACCAACAACTGCTCGCCGCCGCTTTTCCCGGCTATGCGCAGGCGGCAA
ACCGGCTGGTGCGCGACGTGGCCGTTGACCATCTGCAACAGCAACTGAACGCCTTTGTCGCCCTGCCGCC
CAACAGTCCTCAGCGTACCGCCACCGGTGAACAACGCTATAAGCAGCTTAAGGCATTGCTGATGACTTCC
CGCCCGGAAAAGGCCGACGCTGCCTTTTTCAGTACCACGCTGATGGCGGACGGTCTGCGCTACGAGAATA
TCCCGGAAGGTGTGCGGCAGAGCGTGTTGCCGTCACTGCTGACCTTCTGGACGGCGAACCTGCCGGAACA
CCCGCAGTGGAAAACATCGCCGCCACCGGAACTGACCGGCGCAGTGCGTAAAATCCTGCTGCGCCAGATT
GGTGTGCGTAATGCCGAAAACACCCTCTACCAGAACGTGCTGCAACAGGTGTCCCGCAACTACGCCGATA
TGACGCTGGCGGACATGACCGGGGATACCCTCACCGAATCTCTTTTCAGTACGGAACAGACGGTGCCGGG
GATGTTCACCCGTCAGGCGTGGGAAGGACAGGTCAGGGAAGCCATCGAGCAGGTGGTGACGGCGCGGCGC
GAGGAAATCGACTGGGTACTCAGCGACCGCCAGCAGGATACCTCTGCGGATATCTCGCCGGATACGCTGC
GTAACCGTCTCACCTCACGCTACTTTACCGACTTTGCCGGAAGCTGGCTGGCGTTTCTCAACAGCATTCA
CTGGAAAAAGGAAGACTCGCTCTCCGGCATTCTCGACCAGCTGACACTGATGGCCGATGCCCGTCAGTCG
CCACTGATTGCGCTGACGGACACCCTCGCGTGGCAGGCGGCGACAGGCAGGGAAAACCGTGGTCTGTCAG
ACTCGCTGGCGAAATCGGCACAGGAACTGTTTAACGGCAAGGAGAAAACGCCGCAGCAATCCCGTGAAGG
TGACGACGTGCCTGTCGGGCCGCTGGATAAAACCTTCACGCCGCTGCTGCGTTTGCTGGGCGATAAGGCC
GGAGGCGGCGACAGCCAGCTGAGTCTACAGACCTACCTCACCCGCGTCACCCGCGTGCGCCTCAAACTGC
AACAGGTGACCAACGCCCCCGACCCGCAGGAGATGACCCAACAACTGGCGCAGACGGTCTTACAGGGTAA
AACCGTTGACCTCACCGACACCCGCGACTACGGACGGTTAATCGCCGCCAGTCTGGGCGAAGAATGGAGT
GGCTTCGGTCAGGCGCTGTTCGTTCGCCCGGTAGAGCAGTCGTGGCGGCAGGTGCTGACGCCTGCGGCGG
ACAGCCTGAACCGCCAGTGGCAGCGGGCGATTGTCAGCCACTGGAATCAGGACTTCGCTGGCCGCTATCC
GTTCAAAGCCTCACAGAACGATGCCTCCCTCCCCCTGCTGGCGCAGTACCTGCGCGATGACGGGCGCATC
AACCTGTTTATCGCCGCCAACCTTTCCGGCGTGCTGAAACGAGAGGGCCGCTACTGGGTGGCTGACGCCA
TGAACACGCAGGGGCTGACGGTCAATCCGGACTTTATCCGCGCCCTGAACCGCCTGCGCGACGTGGCCGA
TACCGCCTTTGCCAGCGGCGATGCCGGGATACATTTTGAACTGCGGGCAAAACCGGCGCGTGACGTGATG
AAGACGCATCTGGTGATTGACGGGCAGGAGCTGGAATATTTCAACCAGAAAGAACGCTGGCAGCGTTTTA
ACTGGCCGGATGAACAGTGGCAACCCGGCGCATCGCTAAGCTGGACCAGCACACAGGCGATGGAGCGCAT
ACTGGCGGATTACCGGGGAAGCTGGAGTCTTATTCGCCTGCTGGAACAGGCGCAGGTGACGCCGGTGGAC
AGCAGCACCTTTAAGGTGGTGTGGAAAGCGCAGGACGGCCTGCCGCTGAATTACCTGCTACGGGTTGAAC
AGGGTAAAGGGCCGCTGGCGCTGCTGGAGCTGAAAAACTTCCGCCTGCCGGGACAGGTGTTTCTGACCGG
AAAAAGTATGAAGGATGTGGAAGAGTATGGGGAAGACGCCGATGAGTGA
 Primer design