SecReT6
Protein ID: 269139788
SecReT6 ID372
T6SS typei4b
Gene symbolevpO
Locus tagETAE_2443
StrainEdwardsiella tarda EIB202
Repliconchromosome [GenBank: NC_013508] [Browse all T6SS(s) in this replicon]
Location [Strand]2571554..2575336 [+]
Producttype VI secretion system protein EvpO
NoteTssM
UniProt IDD0ZB44
KEGG IDetr:ETAE_2443
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.90E-52, Aligned region: 169..423
DUF1215 [PF06744], Evalue: 0.0016, Aligned region: 938..988
DUF1215 [PF06744], Evalue: 0.0016, Aligned region: 1006..1022
Protein Sequence: 1260 a.a.     [Download]
>gi|269139788|ref|YP_003296489.1| evpO gene product [Edwardsiella tarda EIB202]
MKRLFKWIAIVVLLSVLAMLCWLLTLWQRWPAAAAWVLFLAILAGALLTRYLWRKVRAWRTRSLEAEPVE
KARAAERHPMTLQRQWKAATTLLKHSQLRRFRHPLQVLPWFMLLGRPGSGKSALLAQSGLAAPLDLPHEL
NDGKAPVDWWYFDKAVILDISGQFVQPEASQETRSTWNRMLDLLGRDRARAGLNGLVLTVSAQTLLSADG
GGVVDEGRLIRTRIEQLIRLFDRRFPVYVLVTQIDSLYGMEAWSHLLTPEALDQAMGHVVDEPENGRDVR
DVIDIALGRVNSRLKTMQLTMLLQHPDADPALLMFPTELARLAEPLKRYVYHALGDSPYLESPILRGVFF
ASAVQKGNTRSGPEDQQEIALQEAAHDTVKRGVFVRDLFNRVLPADRHLNRPVAVTSPWRRLNRHLGLFA
WWLCVAAALGYLGVSVVYWQHTLDDLRQRYPATMAMNRALPHDMQMMIAQRDAIYWLENRNAQWASRVLA
FQHQLLSVEADAKSQYVNDFSQYILPSLDKAIQQSTTADSIASHPDGLVNAIQVEVRRANLLRARLRGSS
YGALMAMPPIPTPPLRLLYPALDSDTVSRFNDLFLAQLAWSTDIQQQNARLLHLQARLRQLAAQSATLDW
IIPWANAQPDLTSVTLDDFWQGSLRPDKLPEVDAAYTLEGQQRIRAFLVEMRSSMPNDIAFDKKRAAFWH
EYAQKRLQAWQDFAGQFSQGERILAGQGEWQSTIDRLPHDDNPYLRLARRLLTEFAEMPDDLRPGWLRVL
PQWLEIRQRAHQQALVRVPGLVSDVGGMILRGTAQKGALDQTRSQLVGRLDAIRLYQEYQAAMTQAMNSV
VISQAQATKVAADFHGFDSQQSGQSSLQTAYARLMSLRSLLGYNRPDEQLTWGLMAGPLQLVIRYADQQA
SCFLQSAWQDRVIAPSRWTLNQAERADKLYGDNGLLWTFLSGPIKPFIQRNDSGWQEVDTLGQSVPFTAD
FLPFINRALIRQVDLKAGKIALHQKQQQATLAQQQQKQRWQTVAAESGEKLAELNTAAAALKAKSYPVAL
TGLPTDVNSNAKAKVVGTLLTMQCTNATLRLNNLNFAVMQSVLWSQQQCGQVTLQIRLPAFTLTRSYPGP
QGFVHFLRDFPGGARRFTPADFPVDKSRMAAVGLTQITVRYRIAGQETLLQDAAQLAQAERDIQSAQTRQ
QQAQQALLTLNRPSASESLPPLDTLPGLTMMSVPERIGQCWRGDIRLARENDGIGRLMSELVAKQLSDKP
 
Nucleotide Sequence: 3783 bp     [Download]
>gi|269137358|ref|NC_013508.1|:2571554-2575336 Edwardsiella tarda EIB202 chromosome, complete genome
ATGAAACGTCTCTTCAAATGGATAGCGATCGTCGTGCTCCTGAGCGTACTGGCGATGCTGTGCTGGCTGC
TCACGCTGTGGCAACGCTGGCCCGCCGCCGCCGCATGGGTGCTGTTTCTCGCCATTCTGGCCGGCGCCCT
GCTGACCCGCTATCTCTGGCGTAAGGTGCGGGCATGGCGTACCCGCAGCCTGGAGGCGGAGCCGGTTGAA
AAAGCCCGAGCCGCGGAGCGCCATCCCATGACGCTACAGCGCCAGTGGAAAGCCGCCACGACCCTGCTGA
AGCACTCTCAGCTGCGCCGGTTCCGCCACCCGCTGCAGGTTCTGCCCTGGTTTATGCTGCTGGGCCGCCC
GGGATCGGGAAAATCGGCGCTGCTGGCGCAGTCGGGCCTGGCCGCCCCCTTGGATTTGCCCCATGAGCTC
AATGACGGCAAGGCGCCCGTCGACTGGTGGTATTTCGACAAGGCCGTCATTCTGGATATCTCCGGCCAGT
TCGTACAGCCGGAGGCATCACAGGAGACCCGCTCCACCTGGAACCGGATGCTGGATCTGCTGGGGCGCGA
TCGCGCCCGGGCCGGATTGAACGGGCTGGTGCTCACGGTATCGGCCCAGACCCTGCTGTCCGCAGACGGG
GGCGGCGTGGTCGACGAGGGACGGCTGATCCGCACTCGCATAGAGCAGCTGATCCGTCTGTTCGACAGGC
GCTTCCCCGTCTACGTGCTGGTGACCCAAATCGACAGCCTGTACGGCATGGAGGCCTGGTCCCACCTGCT
GACCCCGGAGGCGCTGGATCAGGCCATGGGCCATGTGGTGGACGAACCGGAGAACGGCCGCGACGTCCGC
GACGTGATAGATATCGCCTTGGGTCGGGTCAATAGCCGGCTGAAAACCATGCAGCTGACGATGCTGCTGC
AGCACCCGGATGCCGATCCGGCCTTACTGATGTTCCCCACCGAGCTGGCCAGGCTGGCCGAGCCCCTCAA
GCGCTATGTCTATCATGCCCTGGGAGACAGCCCCTATCTGGAGTCGCCCATCTTGCGCGGCGTATTCTTC
GCCAGCGCGGTCCAGAAGGGAAACACCCGCAGCGGGCCCGAAGATCAGCAGGAGATTGCGCTGCAGGAGG
CGGCGCATGACACCGTCAAACGCGGGGTCTTTGTCCGGGATCTGTTTAACCGCGTCCTGCCGGCCGACCG
TCATCTGAACCGCCCCGTCGCCGTGACCAGTCCCTGGCGGCGCCTGAACCGCCATCTGGGCCTGTTCGCC
TGGTGGCTGTGCGTGGCCGCCGCCCTCGGGTATCTCGGCGTATCGGTCGTATACTGGCAGCACACGCTGG
ACGATCTGCGCCAGCGCTATCCGGCGACCATGGCCATGAATCGCGCCCTGCCCCACGACATGCAGATGAT
GATAGCCCAGCGGGATGCGATTTATTGGCTGGAAAACAGAAACGCGCAGTGGGCCAGCCGGGTACTGGCA
TTCCAGCATCAGTTGCTCTCGGTTGAAGCGGATGCAAAATCGCAGTATGTAAATGACTTTAGCCAATATA
TTTTACCCAGCCTGGACAAGGCGATTCAGCAGAGCACCACGGCGGACAGCATCGCATCCCATCCCGACGG
GCTGGTGAACGCCATTCAGGTGGAGGTCCGCCGCGCCAACCTGCTACGGGCGAGGCTGCGAGGCTCCAGC
TACGGAGCGCTGATGGCCATGCCCCCGATACCAACGCCCCCCCTGCGGTTACTGTACCCGGCGCTGGATT
CGGATACGGTATCCCGTTTCAATGACCTGTTCCTGGCCCAGCTGGCCTGGTCAACGGATATCCAGCAGCA
GAACGCCCGCCTGCTGCACCTGCAGGCGCGGCTCCGGCAGTTGGCGGCGCAAAGCGCCACCCTGGACTGG
ATCATTCCCTGGGCAAACGCCCAGCCGGATCTGACCAGCGTGACCCTGGACGACTTCTGGCAGGGCTCAC
TGCGGCCGGATAAATTGCCGGAGGTCGATGCGGCCTACACCCTGGAGGGGCAGCAGCGTATCCGCGCATT
CCTGGTGGAGATGCGCAGCAGCATGCCGAACGACATCGCCTTCGACAAAAAACGGGCCGCCTTCTGGCAT
GAATATGCGCAGAAGCGCTTGCAGGCCTGGCAGGACTTCGCCGGACAGTTCTCTCAGGGAGAGCGGATCC
TGGCAGGTCAGGGAGAGTGGCAGAGCACCATTGACAGACTGCCCCACGATGACAACCCGTATCTGCGCCT
TGCCCGCCGCCTGTTGACCGAGTTTGCCGAGATGCCGGATGACCTGCGCCCGGGCTGGCTCCGGGTGCTC
CCGCAGTGGCTGGAGATACGCCAGCGCGCCCACCAGCAGGCCCTCGTCAGGGTCCCCGGACTGGTCAGCG
ATGTGGGCGGCATGATCCTGCGCGGGACGGCGCAGAAGGGGGCGCTGGATCAGACCCGCAGCCAGCTCGT
CGGCCGGCTGGATGCCATCCGCCTGTATCAGGAGTATCAGGCGGCCATGACCCAGGCCATGAACAGCGTC
GTCATCAGCCAGGCCCAGGCCACCAAAGTGGCGGCGGACTTCCATGGCTTTGACAGCCAGCAGAGCGGGC
AGTCCTCACTGCAGACGGCCTATGCACGCCTGATGAGCCTGCGCAGCCTGCTGGGATACAATCGGCCCGA
TGAACAGCTCACCTGGGGGCTGATGGCGGGCCCCTTGCAGCTGGTCATTCGCTATGCCGATCAGCAGGCC
TCCTGCTTCCTGCAGAGCGCGTGGCAGGACCGCGTCATCGCGCCATCGCGCTGGACCCTCAATCAGGCCG
AGCGGGCGGATAAGCTGTACGGTGACAATGGGTTGCTCTGGACCTTTTTATCCGGGCCGATTAAGCCGTT
TATCCAACGTAACGATAGCGGCTGGCAGGAGGTGGATACGCTGGGGCAGTCCGTCCCCTTTACCGCAGAC
TTTCTGCCATTCATCAACCGGGCCCTTATCCGCCAGGTTGATCTGAAGGCCGGGAAAATCGCGCTACACC
AGAAACAGCAGCAGGCCACCCTGGCCCAGCAGCAGCAAAAGCAGCGCTGGCAAACCGTGGCCGCCGAGTC
TGGCGAAAAGCTGGCCGAGCTGAACACCGCCGCCGCCGCCCTGAAGGCGAAAAGCTATCCCGTCGCCCTG
ACGGGGCTGCCGACGGACGTCAACAGCAACGCCAAGGCCAAGGTCGTGGGAACCCTGCTGACCATGCAGT
GTACCAATGCCACGCTACGGCTAAACAACCTTAACTTTGCCGTGATGCAAAGCGTACTCTGGTCACAGCA
GCAGTGCGGCCAGGTGACGCTGCAGATCCGGCTCCCGGCCTTCACGCTGACGCGCAGCTATCCCGGGCCT
CAGGGCTTTGTCCACTTTTTACGGGATTTCCCGGGCGGGGCCCGCCGGTTTACCCCGGCGGACTTCCCCG
TCGACAAAAGTCGGATGGCGGCGGTCGGGCTAACCCAGATTACGGTACGCTACCGCATCGCCGGACAGGA
GACGCTGCTGCAGGACGCCGCTCAGCTGGCGCAGGCCGAGCGCGATATTCAGTCAGCCCAGACCCGCCAA
CAGCAGGCGCAGCAGGCCCTGCTGACGCTGAATAGGCCGAGCGCATCGGAGAGCCTTCCGCCGCTGGATA
CGCTGCCGGGGCTGACGATGATGAGTGTGCCGGAGCGCATCGGGCAGTGCTGGCGGGGGGATATTCGCCT
GGCCAGAGAAAACGACGGCATTGGCCGGCTGATGAGTGAACTGGTCGCGAAACAGTTAAGCGACAAGCCG
TAA
 Primer design