SecReT6
Protein ID: 26989346
SecReT6 ID13
T6SS typei1
Gene symbol-
Locus tagPP_2627
StrainPseudomonas putida KT2440
Repliconchromosome [GenBank: NC_002947] [Browse all T6SS(s) in this replicon]
Location [Strand]3003417..3007037 [+]
Producthypothetical protein
NoteTssM
UniProt IDQ88JM2
KEGG IDppu:PP_2627
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 4.80E-83, Aligned region: 110..163
IcmF-related [PF06761], Evalue: 4.80E-83, Aligned region: 524..831
ImcF-related_N [PF14331], Evalue: 5.30E-69, Aligned region: 218..476
DUF1215 [PF06744], Evalue: 1.30E-29, Aligned region: 928..1049
Protein Sequence: 1206 a.a.     [Download]
>gi|26989346|ref|NP_744771.1| unnamed protein product [Pseudomonas putida KT2440]
MNQIWTQLKRWGWPWVTRIGLALPLLLGLGALLMLVAIWWLGPQWTWREQQPLASVAHRSVASLVLVLVP
LLCWLGVLRTRFRRLQAERRQALAAEQDVALPFVQAQERALSQGLERYLDNAGGRRALYRLPWYLVLGDE
QSGKSSFIDRTDQRFTLTRIDQAQARGRQTQAMAYPVGWWVSDDAVIIDPPGVFISQKPPVGSAANAPSE
ASAPPGIQARLWEHLLGWLQRKRSQRALNGVLLVVDLPALLHGRPEQRVALAHGLRTRLYEVSSQLGARL
PLYVVLTKFDLLDGFDQFYSQLPAAKRKSLLGFTFKLDAVDAFDAWLDEYDEHYGRLLTQLQEQVIDRLD
VLGKTAPCGRLFSLHAQLIGLRPILQAFLRETLASDRFTTPPLVRGVYWSSVVQQGDMRNAFVREAAQPY
TTKLPLREGKAQGKALVYFIQQAFRRVIYQEAGLAGDNVRVARSKRHLLWVGSGVGILAFSIAVASWQRY
ADINGAKAASVLAKSQEYSGHEVDMRLDPTGRNLLAPLDQIRDAVAVFGDYRAAWPVVADFGLYQGRNIG
PLVDEAYLSLLSKRFLPALASGVIDAMNAAPPGSEQQMAALRVYRMIEDRNSRRPEWVEDWMARQWQRAF
PGQGQLQRDLMQHLKYALAYADTDLPQYRQRVSEVQQALRKLPLPQRVYAGLKQQSYQQLHAGLDLRHQV
GPAFDVVYQPSSGARQGDEDVRLAAMLTAKGFREYFEPHSQRFAEMAMVDQWALGERSQLDYSDVDRDAL
TERLYNLYSADYIDSWRRALTAFTVADFRDLDHGVAILEQLTGPAAPLQRLLDTVRDNTSLAPPAAVEAS
GELSTLRVATGKPEQQQALAIQRAFAGLGAMLQATGEKPSYYDETLGAVAAVLDYAKAVQDSPDRGKAAL
QAVHQRFAMTGQDPIGTLQRIATGLPEPISHQVRKLADQTAQVLNVEALRELERRWDADVYSFFQQRLAG
RYPFVVKAPDASLDDFEAFFGPKGRLQQFNDRYLKVFLKDNLEALQSAQHGQSLIRADVIEQLELAERIR
ETFFDQRGKLSVQFSIEPLGLSANQRTSLLDLDGQLIAYTHGPSHITGIVWPNTLGQQVRSNLTLLRQNG
NSSSLEYRGPWSMFRLLSRGALNGRTATSVDLSFRTGDGVMRYRLNAEKAFNPITQQPFKGFRLPRGLLQ
QPASVVQAVLPDGQRL
 
Nucleotide Sequence: 3621 bp     [Download]
>gi|26986745|ref|NC_002947.3|:3003417-3007037 Pseudomonas putida KT2440 chromosome, complete genome
ATGAATCAAATATGGACGCAACTCAAACGTTGGGGCTGGCCGTGGGTAACGCGCATTGGCCTGGCGCTGC
CGCTGCTGCTCGGGCTTGGCGCCTTGCTGATGCTGGTCGCCATCTGGTGGCTTGGCCCGCAATGGACGTG
GCGTGAGCAGCAGCCGCTGGCAAGTGTGGCTCATCGCAGCGTGGCAAGCCTGGTGCTGGTGCTGGTGCCG
CTTCTGTGCTGGCTTGGGGTGCTGCGCACGCGCTTTCGCCGCCTGCAAGCGGAGCGCCGCCAGGCACTGG
CCGCCGAACAGGATGTCGCGCTACCATTCGTGCAGGCGCAAGAGCGGGCCTTGAGCCAGGGGCTTGAGCG
GTACCTCGACAATGCCGGTGGGCGACGCGCGTTGTACCGGCTGCCCTGGTACCTGGTGTTGGGCGACGAA
CAGTCCGGTAAAAGCAGCTTCATCGACCGCACCGATCAGCGCTTTACCCTGACGCGTATCGACCAGGCCC
AGGCACGGGGCCGACAGACTCAAGCAATGGCCTACCCGGTAGGCTGGTGGGTCAGCGACGATGCCGTGAT
CATCGACCCGCCCGGTGTTTTCATCAGTCAAAAACCACCGGTGGGCTCGGCGGCCAACGCCCCCTCCGAA
GCCTCCGCGCCGCCCGGCATCCAGGCCCGGTTATGGGAGCACCTGTTGGGCTGGCTGCAGCGTAAGCGAA
GCCAGCGGGCGCTCAATGGAGTGTTGCTGGTGGTCGACCTGCCGGCGTTGCTGCATGGCAGGCCCGAGCA
GCGCGTCGCGCTGGCCCATGGGTTGCGCACACGCCTGTACGAAGTGAGCAGTCAGTTGGGGGCGCGCCTG
CCGCTGTACGTGGTACTGACCAAATTCGATCTGCTGGACGGCTTCGACCAGTTCTACAGCCAGCTTCCGG
CCGCCAAGCGTAAAAGCCTGTTGGGGTTCACCTTCAAGCTGGATGCGGTTGACGCGTTCGACGCCTGGCT
GGATGAGTATGACGAGCACTACGGGCGGCTTCTCACCCAATTGCAGGAGCAGGTCATCGACCGGCTGGAT
GTACTGGGCAAGACAGCGCCGTGCGGGCGCCTGTTCTCACTGCATGCACAGTTGATCGGGTTGCGCCCCA
TACTGCAGGCATTCCTGCGCGAAACCTTGGCGAGTGACCGGTTCACCACGCCACCCTTGGTACGTGGTGT
GTACTGGTCGTCAGTGGTACAGCAAGGCGACATGCGCAATGCCTTTGTCCGAGAAGCGGCTCAGCCCTAC
ACGACGAAGCTGCCCCTGCGTGAAGGTAAGGCACAGGGGAAGGCGTTGGTCTATTTCATCCAGCAAGCAT
TCAGGCGGGTTATCTATCAGGAAGCCGGGCTGGCGGGTGACAATGTTCGGGTTGCGCGCAGCAAGCGCCA
CTTGCTGTGGGTGGGCTCTGGTGTAGGCATCCTGGCGTTCAGTATCGCCGTTGCCAGCTGGCAGCGTTAC
GCCGACATCAATGGCGCCAAGGCTGCCAGTGTGCTCGCCAAAAGCCAGGAGTACAGCGGTCACGAAGTCG
ATATGCGTCTTGATCCGACCGGGCGCAACCTGCTGGCGCCACTGGACCAGATTCGCGATGCGGTCGCGGT
GTTTGGCGACTATCGTGCGGCCTGGCCGGTGGTTGCCGATTTTGGCTTGTATCAAGGGCGCAACATTGGT
CCCTTGGTTGATGAGGCGTACCTCAGCTTGTTGTCTAAACGTTTCTTGCCGGCCTTGGCCAGTGGTGTGA
TCGATGCCATGAACGCAGCACCACCTGGCAGCGAGCAACAAATGGCCGCGCTCAGGGTTTACCGGATGAT
CGAGGACCGCAACAGCCGCCGGCCCGAATGGGTCGAGGACTGGATGGCCCGTCAGTGGCAACGGGCCTTT
CCTGGCCAGGGGCAGTTGCAGCGTGACCTCATGCAGCACCTGAAATACGCCTTGGCCTATGCCGATACCG
ATTTGCCGCAGTACCGCCAGCGGGTCAGCGAAGTGCAGCAGGCGCTGCGCAAATTGCCGTTGCCACAGCG
GGTCTATGCAGGGCTGAAACAACAATCGTACCAGCAGTTGCACGCCGGGCTGGACCTGCGCCACCAGGTA
GGGCCTGCGTTCGATGTGGTGTACCAGCCGTCTTCCGGGGCCAGGCAAGGGGATGAGGATGTACGGCTGG
CCGCCATGCTCACCGCCAAAGGCTTCAGGGAATACTTCGAGCCGCACAGCCAACGCTTCGCTGAAATGGC
GATGGTTGATCAATGGGCATTGGGGGAGCGCAGTCAACTCGACTATTCGGACGTCGACCGCGATGCGCTG
ACCGAGCGGCTGTATAACCTCTACAGCGCCGATTACATTGACAGCTGGCGGCGCGCCCTGACCGCTTTTA
CGGTGGCTGACTTCCGTGATCTGGACCATGGTGTCGCGATCCTGGAGCAGTTGACCGGCCCCGCAGCACC
ATTGCAACGGCTGCTGGATACGGTCAGGGATAACACCTCGCTTGCGCCTCCAGCAGCTGTTGAAGCATCG
GGTGAGCTGAGTACGCTGCGCGTAGCAACCGGAAAACCCGAGCAACAGCAAGCGTTGGCCATCCAGCGGG
CGTTTGCAGGCCTTGGCGCCATGCTGCAGGCGACAGGAGAAAAGCCGAGCTACTACGATGAAACCCTTGG
CGCTGTTGCGGCCGTGCTGGACTACGCCAAGGCCGTACAGGACAGCCCGGACCGCGGCAAGGCTGCTTTG
CAGGCCGTGCATCAGCGCTTTGCGATGACAGGGCAGGACCCGATAGGCACCCTCCAACGTATTGCCACAG
GTTTACCGGAGCCTATCAGCCACCAGGTCAGAAAGCTCGCCGACCAGACTGCCCAGGTGCTGAACGTTGA
AGCACTGCGCGAACTGGAGCGACGTTGGGATGCTGACGTGTACAGTTTTTTCCAGCAACGCCTGGCAGGC
CGCTACCCCTTTGTGGTGAAGGCACCCGATGCTTCTTTGGATGACTTCGAGGCGTTCTTCGGGCCGAAAG
GGCGCCTGCAGCAGTTTAATGATCGGTATCTCAAGGTTTTCCTGAAGGACAACCTTGAGGCCTTGCAGTC
CGCTCAGCACGGGCAATCCCTGATTCGTGCCGACGTGATCGAGCAGCTCGAGCTGGCGGAGCGCATCCGC
GAAACCTTCTTCGATCAGCGTGGCAAGCTAAGTGTGCAGTTCAGCATCGAGCCCTTGGGGCTCAGTGCAA
ACCAGCGTACCAGCCTGCTGGACCTGGATGGCCAGTTGATTGCCTACACCCATGGGCCAAGCCATATCAC
GGGTATTGTCTGGCCCAATACCTTGGGGCAGCAGGTCCGCAGCAATCTCACCTTGCTAAGGCAAAATGGC
AACAGCAGCAGCCTGGAGTACCGTGGCCCGTGGTCGATGTTCCGCTTGCTCAGCCGCGGTGCGCTCAATG
GCCGGACGGCGACCAGCGTGGACCTGAGCTTCAGGACCGGAGATGGCGTGATGCGCTATCGGCTTAACGC
TGAAAAAGCCTTCAATCCCATTACCCAGCAACCTTTCAAAGGCTTCCGCTTGCCCCGAGGCTTGTTGCAA
CAGCCAGCCAGTGTGGTGCAGGCGGTGCTACCGGATGGGCAGCGACTATGA
 Primer design