SecReT6
Protein ID: 26989807
SecReT6 ID14
T6SS typei4b
Gene symbol-
Locus tagPP_3088
StrainPseudomonas putida KT2440
Repliconchromosome [GenBank: NC_002947] [Browse all T6SS(s) in this replicon]
Location [Strand]3476877..3477962 [-]
Producthypothetical protein
NoteTssA
UniProt IDQ88IB1
KEGG IDppu:PP_3088
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 5.40E-22, Aligned region: 58..118
ImpA-rel_N [PF06812], Evalue: 5.40E-22, Aligned region: 241..257
Protein Sequence: 361 a.a.     [Download]
>gi|26989807|ref|NP_745232.1| unnamed protein product [Pseudomonas putida KT2440]
MPEILNDLSLATLVAPIEGGSGEDLSFSALFDQIKEARRADPDYLTQGDWQTDLKTADWEQVINLSAQGL
AQQSKDLMLVAWLCEGLAQREHFEGITFGLELTEQLLVAFWETLYPTLEDGLDERAARLSWLKTTLTDIA
GGLPIIQGQNFGVLRYDESRHVENLALQNPKAMQTALNEGKINAEIFQRSVALTDTDYLRAKAQQIATSL
NACKRLQASADRLFGHEAPSFASLADMLSRASQLAEKLLKDRGVELHPAIPEEAQPQAMAANLHEAGEPM
NATPPTTAPAALRTTPLTRDEAFTMLAGIAQYFKQSEPQSPVPYLIERAIKWGNMPLEGWLSDVIKDNNV
VDNIRDVLGTR
 
Nucleotide Sequence: 1086 bp     [Download]
>gi|26986745|ref|NC_002947.3|:c3477962-3476877 Pseudomonas putida KT2440 chromosome, complete genome
ATGCCTGAAATTCTCAATGACCTCTCGCTGGCCACACTGGTCGCCCCTATCGAGGGTGGCAGTGGCGAAG
ACTTGAGCTTCTCTGCCTTGTTCGATCAGATCAAGGAGGCACGCCGGGCGGACCCTGACTACCTGACCCA
GGGCGACTGGCAAACCGACTTGAAGACTGCCGACTGGGAGCAGGTGATCAACCTGTCGGCTCAAGGGCTT
GCGCAGCAAAGCAAAGACCTGATGCTGGTGGCCTGGCTCTGCGAGGGGCTGGCCCAGCGTGAACACTTCG
AAGGCATCACCTTTGGCCTCGAGCTGACCGAACAGCTCCTGGTTGCGTTCTGGGAAACACTGTACCCCAC
CCTCGAAGACGGCCTGGACGAGCGCGCGGCGCGACTGTCCTGGCTGAAGACCACGCTCACCGACATTGCC
GGTGGCTTGCCCATTATCCAGGGGCAGAATTTTGGCGTGTTGCGCTATGACGAATCACGCCATGTAGAGA
ACCTCGCCTTGCAAAACCCCAAGGCGATGCAGACAGCACTGAACGAAGGCAAGATCAACGCCGAGATCTT
CCAGCGCTCGGTAGCGCTTACCGACACCGATTACCTGCGCGCCAAGGCGCAGCAGATCGCTACCAGCCTG
AATGCATGCAAACGCCTGCAGGCCAGCGCCGACCGCCTGTTCGGCCACGAGGCGCCCAGCTTTGCCAGCC
TTGCCGACATGCTTTCGCGTGCCAGCCAGCTGGCGGAAAAACTGCTCAAGGACCGCGGCGTAGAGCTACA
CCCCGCCATCCCGGAAGAAGCACAGCCACAGGCCATGGCTGCCAACCTCCACGAAGCAGGTGAGCCGATG
AATGCCACGCCCCCGACGACCGCGCCTGCAGCCCTGCGCACCACCCCGCTGACCCGCGACGAGGCATTCA
CCATGCTTGCGGGCATCGCCCAGTACTTCAAACAGAGCGAACCGCAAAGCCCGGTACCCTACCTGATCGA
ACGTGCGATCAAGTGGGGCAACATGCCGTTGGAAGGCTGGTTGAGTGACGTGATCAAGGACAACAATGTG
GTGGACAACATCCGCGATGTGCTGGGCACCCGCTAG
 Primer design