SecReT6
Protein ID: 26989808
SecReT6 ID14
T6SS typei4b
Gene symbol-
Locus tagPP_3089
StrainPseudomonas putida KT2440
Repliconchromosome [GenBank: NC_002947] [Browse all T6SS(s) in this replicon]
Location [Strand]3478058..3478600 [-]
Producthypothetical protein
NoteTssD
UniProt IDQ88IB0
KEGG IDppu:PP_3089
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.40E-41, Aligned region: 14..154
Protein Sequence: 180 a.a.     [Download]
>gi|26989808|ref|NP_745233.1| unnamed protein product [Pseudomonas putida KT2440]
MLLMESFTMAFDAYIQIDGIPGEVLDEKHKDWIEVLGYEYGATQATSATASSSGGASSERVALSDFKIRK
AVDKASAKLFEHCCTGKHIAKLKLNVNRAGGDKVTYLTIDMEEVVVSSVKFVAGGNQSGEDKAVSDLPVE
EISFNFARIKTTYTQQNRTDGQAGGNIVGGWDRTANKVFA
 
Nucleotide Sequence: 543 bp     [Download]
>gi|26986745|ref|NC_002947.3|:c3478600-3478058 Pseudomonas putida KT2440 chromosome, complete genome
ATGTTGTTAATGGAGAGTTTCACAATGGCATTTGACGCGTATATCCAAATCGACGGCATCCCAGGCGAAG
TACTGGATGAAAAACACAAGGACTGGATCGAAGTGCTGGGCTACGAGTACGGCGCCACCCAGGCTACGTC
GGCAACCGCCAGCTCCTCGGGCGGTGCGTCCTCCGAGCGCGTTGCCCTGAGCGACTTCAAGATCCGCAAG
GCAGTCGACAAGGCATCGGCCAAACTGTTCGAACACTGCTGCACCGGCAAGCACATCGCCAAGCTGAAGC
TGAACGTGAACCGTGCCGGTGGCGACAAGGTCACCTACCTGACCATCGACATGGAAGAAGTGGTGGTCTC
TTCGGTCAAGTTTGTCGCCGGTGGCAACCAGAGTGGTGAAGACAAGGCGGTCAGCGACCTGCCCGTTGAA
GAAATCAGCTTCAACTTTGCCCGCATCAAGACCACCTACACCCAGCAGAACCGCACCGACGGCCAGGCCG
GCGGCAACATCGTGGGTGGCTGGGACCGCACCGCGAACAAAGTGTTTGCCTAA
 Primer design