SecReT6
Protein ID: 26989809
SecReT6 ID14
T6SS typei4b
Gene symbol-
Locus tagPP_3090
StrainPseudomonas putida KT2440
Repliconchromosome [GenBank: NC_002947] [Browse all T6SS(s) in this replicon]
Location [Strand]3478720..3481215 [-]
ProductOmpA domain-containing protein
NoteTssM
UniProt IDQ88IA9
KEGG IDppu:PP_3090
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.40E-67, Aligned region: 90..111
ImcF-related_N [PF14331], Evalue: 2.40E-67, Aligned region: 189..453
OmpA [PF00691], Evalue: 5.40E-16, Aligned region: 716..810
IcmF-related [PF06761], Evalue: 3.20E-09, Aligned region: 94..133
IcmF-related [PF06761], Evalue: 3.20E-09, Aligned region: 497..641
Protein Sequence: 831 a.a.     [Download]
>gi|26989809|ref|NP_745234.1| unnamed protein product [Pseudomonas putida KT2440]
MNKLKYYCLRYQPYLLGVAFFLAIFLVWAIGRAFGFASLHSLLAGIGVFLLLSAGYVLLLYRGVGQHHNL
EGLLRDDADQAVLSAAPADREEVSLLRERLLQGIERLHSNKPRGTSNKDALYALPWYLVIGQPAAGKSTM
ILQSGLNFPYAEREGVRVAGLGGTRNCDWFFSSEAVLLDTAGRYMNSPEEAGKWRGFLQLLRQHRQRRPL
NGLIVSVSIADILHGSVEDQERVAKRLRERIQESCALLEVRLPIYLVFTKCDLIPGFTAFYRQLDDAARG
EVMGKTFSHKGYEQADWGQRFSNAMDELTRYWGQMASQQLVQQDIQVTRRNDAAYRFPLELAALKPRLHQ
FVDSLLRANPYQNAEMLRGFYFTAALQADEAQWGCHGQHVAERFALEHAEGTGTAGSQPAPLFINSLFRK
VIIPDQHLVALYTSNHRERRRKAGWVGAAGLAALVLCSLWGWSYLNNRATLASIADELAQAKADDQAASG
QYTAWRSLDRLRFWAAHYHEQHHAKGVPLGMRLGLYQGHEVEPLLRDRYFATLQNVMLKPTADNLTRTLY
LLTTLKVYQRNTRELQPVSGIDSVEAEALPHDNRAQSIANFGKAALDTYVMLSPGQREHADPAFLKAHLP
DYWYPAIARQTGKSMAAAGSEAGGNQDYLYASRQITFYSDQIREPDVPRILDNAFLMSSSRNYIDSLRAQ
SLRAIETITLESDTLFAFGRADFQSLKNEGQHQLSAIASKLLNTPNIGKIIISGHADQLGDSQGNLQVSK
QRAQTIRTYLVGKGVPAELVVAQGEGSRKPLVNCDMQQPRTQLIKCLEPNRRVEIEVRGLN
 
Nucleotide Sequence: 2496 bp     [Download]
>gi|26986745|ref|NC_002947.3|:c3481215-3478720 Pseudomonas putida KT2440 chromosome, complete genome
ATGAACAAGCTCAAGTACTACTGCCTGCGCTACCAACCCTACCTGCTGGGCGTGGCGTTCTTCCTGGCGA
TCTTCCTGGTCTGGGCCATCGGCCGCGCCTTCGGCTTCGCCTCGCTGCACAGCCTGCTGGCCGGGATCGG
TGTGTTTCTGCTGCTGTCGGCGGGCTATGTACTGCTGCTGTACCGCGGCGTGGGTCAGCACCACAACCTT
GAAGGCCTGCTGCGCGACGACGCCGACCAGGCCGTACTCAGTGCAGCCCCGGCCGACCGGGAAGAAGTCA
GCCTGTTGCGCGAGCGCCTGCTGCAGGGCATCGAGCGCCTGCACAGCAACAAGCCGCGCGGTACTTCGAA
CAAGGATGCCCTGTATGCCCTGCCCTGGTACCTGGTCATTGGCCAGCCTGCCGCCGGCAAGAGCACGATG
ATACTGCAGTCGGGCCTGAACTTCCCCTATGCCGAGCGCGAAGGCGTGCGGGTCGCGGGCCTGGGCGGCA
CGCGCAACTGCGACTGGTTCTTCAGCTCTGAAGCGGTACTGCTGGACACTGCCGGGCGTTACATGAACAG
CCCCGAGGAAGCCGGCAAGTGGCGCGGCTTTTTGCAACTGCTGCGCCAGCACCGCCAGCGCCGTCCCCTT
AACGGCTTGATCGTCAGCGTCAGCATCGCCGATATTCTGCATGGCTCGGTCGAAGACCAGGAGCGCGTGG
CCAAGCGCCTGCGCGAACGCATTCAGGAAAGCTGCGCGCTGCTTGAAGTGCGCCTGCCAATCTACCTGGT
TTTCACCAAGTGCGACCTGATCCCTGGTTTCACCGCGTTCTATCGCCAGCTGGACGACGCCGCGCGTGGT
GAAGTGATGGGTAAAACCTTCTCTCACAAGGGGTACGAGCAAGCCGACTGGGGCCAACGCTTCAGCAATG
CGATGGACGAGCTGACGCGTTACTGGGGGCAGATGGCGAGCCAGCAGCTGGTGCAGCAGGACATACAAGT
CACCCGGCGGAACGACGCTGCCTACCGCTTCCCGCTGGAGCTGGCCGCGCTCAAGCCGCGCCTGCATCAG
TTCGTCGACAGCCTGCTGCGTGCCAACCCTTACCAGAATGCCGAAATGCTGCGCGGTTTCTATTTCACCG
CGGCGCTGCAGGCCGACGAGGCTCAGTGGGGCTGCCACGGCCAGCATGTGGCCGAACGCTTCGCGCTCGA
ACACGCAGAAGGTACGGGCACTGCCGGCAGCCAGCCGGCGCCGCTGTTCATCAACAGCCTGTTCCGCAAA
GTGATCATTCCCGACCAGCATTTGGTGGCGCTGTACACCAGCAACCACCGTGAACGCCGGCGCAAGGCCG
GGTGGGTGGGCGCCGCCGGCCTGGCGGCACTGGTGCTGTGCAGCCTGTGGGGCTGGTCGTACCTGAACAA
CCGCGCCACCCTGGCCAGCATTGCCGACGAACTGGCCCAGGCCAAGGCCGACGACCAGGCGGCCAGCGGC
CAGTACACCGCCTGGCGAAGCCTCGACCGCTTGCGCTTCTGGGCTGCTCACTACCATGAGCAACACCACG
CTAAGGGCGTGCCCCTCGGCATGCGCCTGGGCCTGTACCAGGGCCATGAGGTCGAGCCGCTGCTGCGCGA
CCGCTACTTCGCCACGTTGCAGAACGTGATGCTAAAGCCCACGGCCGATAATCTGACCCGCACCCTGTAC
CTGCTGACCACGCTCAAGGTCTACCAGCGCAACACCCGTGAGCTGCAGCCAGTGAGCGGCATTGACAGCG
TAGAGGCCGAGGCGCTGCCCCATGACAACCGCGCCCAGTCGATCGCCAATTTCGGAAAGGCGGCCCTGGA
CACTTACGTGATGCTTTCTCCGGGCCAGCGCGAGCATGCCGACCCGGCGTTTCTCAAGGCGCACCTGCCG
GACTACTGGTACCCGGCCATCGCCCGCCAGACCGGCAAGAGCATGGCCGCCGCTGGCAGCGAGGCCGGTG
GCAACCAGGACTACCTGTATGCCAGCCGCCAGATCACGTTCTATAGCGACCAGATCCGTGAGCCAGATGT
ACCGCGCATCCTCGACAACGCCTTCCTGATGTCCAGTTCGCGCAACTACATCGACAGCCTGCGGGCCCAG
TCACTGCGTGCGATCGAGACCATCACGCTGGAATCCGACACCCTGTTCGCCTTCGGCCGCGCCGATTTCC
AGAGCCTGAAAAACGAAGGCCAGCATCAGCTGAGCGCAATTGCCAGCAAGCTGCTGAACACCCCGAATAT
CGGCAAGATCATCATCTCGGGGCACGCCGACCAACTGGGTGACAGCCAGGGCAACCTGCAGGTTTCGAAA
CAACGGGCGCAAACCATCCGCACCTATCTGGTTGGCAAGGGCGTACCTGCCGAGCTGGTGGTCGCGCAGG
GCGAAGGCAGCCGCAAGCCATTGGTCAACTGCGACATGCAACAACCGCGAACGCAGTTGATCAAGTGCCT
GGAGCCCAACCGCCGGGTGGAAATCGAAGTGCGTGGGCTTAACTGA
 Primer design