SecReT6
Protein ID: 26989810
SecReT6 ID14
T6SS typei4b
Gene symbol-
Locus tagPP_3091
StrainPseudomonas putida KT2440
Repliconchromosome [GenBank: NC_002947] [Browse all T6SS(s) in this replicon]
Location [Strand]3482117..3485920 [-]
Producthypothetical protein
NoteTssM
UniProt IDQ88IA8
KEGG IDppu:PP_3091
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 4.80E-60, Aligned region: 181..435
IcmF-related [PF06761], Evalue: 1.10E-44, Aligned region: 491..555
IcmF-related [PF06761], Evalue: 1.10E-44, Aligned region: 635..878
DUF1215 [PF06744], Evalue: 2.90E-23, Aligned region: 317..343
DUF1215 [PF06744], Evalue: 2.90E-23, Aligned region: 780..821
DUF1215 [PF06744], Evalue: 2.90E-23, Aligned region: 1011..1126
AAA_16 [PF13191], Evalue: 0.00023, Aligned region: 114..258
AAA_16 [PF13191], Evalue: 0.00023, Aligned region: 454..454
AAA_16 [PF13191], Evalue: 0.00023, Aligned region: 881..939
Protein Sequence: 1267 a.a.     [Download]
>gi|26989810|ref|NP_745235.1| unnamed protein product [Pseudomonas putida KT2440]
MKTLLRLLKSFWLLLPLLWLASLLICWLAAPLVPWLRHHVPEALAIISACFLLVIVLRQYQRIRAEHNLE
NLLQIEVDRSWNATGEFRDQQVLRERLKHAITMLRTDRSAGGGGKAALSDLPWYLVVGMSAAGKTSLLTH
SGLSASIATANDSESGTQHCDWYFSPDAVMIDTAGRYLRDDQSASEFSAFLRMLRKQRGKAAINGLVLVV
SLPELLAANSDERNALAAQLVARVEEYAECLDANPPVYLMLSKTDQLPGFSQAFDGLDLHERQQPLGMTF
GLSEIRTNGLHAVLQTRLKKLQAHIRQHVDAQMIALGAEADSTLLNFPQYFAALSGVLEQFLEHFTRGHR
GGAPLLLRGLYFTSALQNGQQLGQVYEDVIADEFALQAAYDEQAGHVGKALGNRSYFITDTFRQVIFPDR
DLILYQSRLGRQAAFSPLLLGLAAATGLLFIGWQALSFANNRQWLDSLRGQLAHIEQAADREQQLAAGKG
LEVLREQMANVKAHRLQGVPLQLGGGLYQGEAIHQVTRSAYLAQLRSQALEPIARSLQVQMRAFNTFANG
INQELEFTPAPQPKKRNGKPLAPAIAARAKAALGNTRAGAYAAKVNLATASDGAELSAATGGLSLSEEML
GRLDEQQVASIIEAYNTLKLYLLLTEPQAHPDPAFVAASLPQAWASAAGEGTPADAGVIAENAPLYVQLL
EQGQAPSLPRNEQLINETRQNLKSFMISSSLVDREYLRLQLESSRQFPALSLNDLVPQPGRALLYGTAGV
PAIYTRQGWDTFVKPELIKLVSGNLRNESDWVLDGEGGDALVQKANFVREFMTRYKRDYTQAWYKMVSSV
GVRHFADLASATRELGLLSDVQNSPVKNLLQAVNDNTQWDLPVKQAIPAPGTSRDDGFWSKVTGLFDAND
TLPANVAPALPAVDDGSLAKRFEPVARVFAENNAEGADSTIMDRYLAALRKLKVRMNNIQRSQDVGKSSK
QLISETLEGQPSEITTVRNYVESSVDTSQDGLSRSLQGLFSLPIQYAWATLRDPAGEQIAKAWAQQIAKP
WEQVMAHRYPIAGSSRNEASVKDLQRFVDPDSGLLPAFKRNEIGNLAGGEGLGVGDGKGPALVNPGMLNS
IDKASSVGQVIASLSDRDNGFEIMLEPSANFTDIVFTLDGQEQHYRNGRSSWNRFAWPGTSTAPGARLDV
VTLSGTRVTVFDFPGRWGLLRMNESARVDDLDGIQQRFSWNTASGRVSLVVRNFGGVKLTDLGDVKALSA
LNSRGAQ
 
Nucleotide Sequence: 3804 bp     [Download]
>gi|26986745|ref|NC_002947.3|:c3485920-3482117 Pseudomonas putida KT2440 chromosome, complete genome
ATGAAAACATTACTGCGTCTGTTGAAAAGTTTCTGGTTGCTGCTGCCATTGCTGTGGCTGGCTAGCCTGT
TGATTTGCTGGCTGGCCGCGCCGCTGGTGCCGTGGCTGCGTCATCACGTGCCTGAAGCGCTGGCAATCAT
CAGTGCCTGCTTCCTGCTGGTAATCGTGCTGCGCCAATACCAGCGTATTCGCGCCGAACACAACCTGGAG
AACCTGCTGCAGATCGAGGTCGACCGCTCGTGGAATGCCACTGGCGAGTTCCGTGACCAGCAGGTGCTGC
GTGAGCGCCTGAAGCACGCCATCACCATGCTGCGCACCGACCGCTCCGCCGGTGGCGGCGGCAAGGCGGC
CCTGTCCGACCTGCCCTGGTACCTGGTGGTCGGCATGTCGGCGGCCGGCAAGACCTCGCTGTTGACCCAT
TCCGGCCTGTCGGCCAGCATCGCTACGGCCAACGACAGTGAAAGCGGCACCCAGCACTGCGACTGGTACT
TCAGCCCCGACGCCGTGATGATCGACACCGCCGGGCGCTACCTGCGCGACGACCAATCGGCCAGCGAGTT
CTCGGCCTTTCTGCGCATGCTGCGTAAGCAGCGCGGCAAAGCGGCGATCAATGGCCTGGTCCTGGTGGTC
AGCCTGCCCGAACTGCTGGCGGCCAACAGCGATGAGCGCAATGCCCTGGCTGCCCAGCTGGTGGCCCGGG
TGGAAGAATACGCCGAATGCCTCGATGCCAACCCGCCGGTTTACCTGATGCTGAGCAAGACCGACCAGTT
GCCGGGCTTCAGCCAGGCTTTCGACGGCCTCGACCTGCACGAACGCCAGCAGCCGCTGGGCATGACCTTT
GGCCTTTCGGAAATCCGCACCAACGGCCTGCACGCCGTGCTGCAGACGCGCCTGAAGAAGCTGCAAGCTC
ATATTCGCCAGCACGTCGACGCGCAGATGATCGCCCTCGGTGCCGAAGCCGACAGCACCCTGCTGAATTT
CCCGCAGTACTTCGCCGCCCTCAGCGGTGTGCTCGAGCAATTCCTCGAACACTTCACCCGCGGCCATCGC
GGCGGTGCCCCGCTGCTGCTACGTGGCCTGTACTTCACCAGTGCACTGCAGAACGGGCAGCAACTGGGGC
AGGTCTATGAAGACGTCATCGCCGACGAATTCGCCCTGCAGGCCGCCTACGATGAACAGGCCGGGCACGT
CGGCAAGGCCCTGGGCAACCGCAGCTACTTCATCACCGACACTTTCCGCCAGGTGATCTTCCCCGACCGC
GACCTGATCCTTTACCAGTCGCGCCTGGGCCGCCAGGCTGCGTTCAGCCCGCTGCTACTGGGCCTGGCCG
CCGCCACCGGGTTGCTGTTCATCGGTTGGCAAGCGCTGTCGTTCGCCAATAACCGCCAGTGGCTGGACAG
CCTGCGCGGGCAGCTGGCGCACATCGAACAGGCAGCAGACCGCGAGCAGCAGCTGGCCGCAGGCAAGGGC
CTGGAAGTGCTGCGTGAGCAGATGGCCAACGTCAAGGCCCATCGCCTGCAGGGAGTGCCCTTGCAGTTGG
GTGGCGGCCTGTACCAGGGCGAGGCGATTCACCAGGTGACCCGCAGCGCCTACCTGGCGCAGCTGCGCAG
CCAGGCGCTGGAACCGATCGCACGCAGCCTGCAAGTGCAGATGCGGGCGTTCAATACCTTCGCCAACGGT
ATTAACCAGGAGCTGGAATTCACCCCGGCCCCGCAGCCGAAGAAGCGCAATGGCAAGCCGCTGGCCCCTG
CCATTGCGGCCAGGGCCAAGGCCGCGCTGGGCAACACCCGCGCTGGCGCCTATGCCGCCAAGGTCAACCT
GGCCACTGCCAGCGATGGCGCCGAGCTGTCCGCCGCCACCGGTGGGCTGTCACTGTCCGAAGAAATGCTC
GGGCGCCTGGACGAGCAGCAGGTGGCCTCGATCATCGAGGCCTACAACACCCTCAAGCTGTACCTGTTGC
TGACCGAGCCCCAGGCCCATCCAGACCCGGCCTTCGTCGCTGCCAGCCTGCCCCAGGCCTGGGCCAGCGC
CGCAGGCGAAGGCACCCCGGCCGACGCTGGCGTGATCGCAGAAAATGCCCCGCTGTACGTGCAGTTGCTG
GAGCAGGGCCAGGCGCCGTCGTTGCCGCGCAACGAACAGCTGATCAACGAAACCCGGCAGAACCTCAAGT
CGTTCATGATCTCCAGCTCGCTGGTCGATCGCGAATACCTGCGCCTGCAGCTCGAGTCGAGCCGGCAGTT
CCCGGCGCTGAGCCTCAACGACCTGGTCCCGCAACCAGGCCGCGCGCTGCTGTACGGAACCGCTGGTGTG
CCGGCGATCTACACCCGCCAGGGCTGGGACACCTTCGTCAAGCCCGAGCTGATCAAGCTGGTGTCGGGCA
ACCTGCGCAACGAGTCGGACTGGGTGCTGGACGGCGAAGGCGGCGATGCCCTCGTGCAGAAGGCCAACTT
CGTGCGCGAGTTCATGACCCGCTACAAGCGCGACTACACCCAGGCCTGGTACAAGATGGTCAGCAGCGTT
GGCGTGCGCCACTTCGCCGACCTGGCCTCGGCGACCCGGGAGCTGGGGCTGTTGAGCGACGTACAGAACT
CGCCAGTGAAGAACCTGCTGCAGGCGGTCAACGACAATACCCAGTGGGACCTGCCGGTCAAGCAGGCCAT
CCCGGCCCCAGGCACCAGCCGCGATGACGGTTTCTGGAGCAAGGTCACCGGTCTGTTCGACGCCAACGAC
ACCCTGCCTGCCAACGTCGCCCCGGCCCTGCCGGCGGTGGACGACGGCAGCCTGGCCAAGCGCTTCGAGC
CGGTGGCGCGGGTGTTCGCCGAAAACAACGCCGAAGGCGCCGACAGCACCATCATGGATCGCTACCTGGC
CGCCTTGCGCAAACTCAAGGTGCGCATGAACAACATCCAGCGCTCGCAGGATGTGGGCAAGAGCAGCAAA
CAGTTGATCAGCGAGACCCTGGAAGGCCAGCCGAGCGAGATCACCACCGTGCGCAACTACGTGGAAAGCA
GCGTCGACACCAGCCAGGATGGCCTGTCGCGCTCGCTGCAGGGGCTGTTCAGCCTGCCCATCCAGTATGC
CTGGGCGACCCTGCGCGACCCGGCCGGCGAGCAGATCGCCAAGGCCTGGGCGCAGCAGATCGCCAAGCCC
TGGGAGCAGGTCATGGCACACCGTTACCCGATTGCCGGCAGCAGCCGCAACGAGGCTTCGGTGAAAGACC
TGCAACGCTTCGTAGATCCCGACAGCGGCCTGCTGCCGGCCTTCAAACGCAACGAAATCGGCAACTTGGC
CGGTGGTGAAGGTCTGGGTGTAGGCGATGGCAAGGGGCCGGCGCTGGTCAACCCTGGCATGCTCAACAGC
ATCGACAAGGCCAGCTCCGTGGGCCAGGTGATCGCCAGCCTGTCAGACCGTGACAACGGCTTCGAAATCA
TGCTGGAGCCTTCAGCCAACTTCACCGACATCGTCTTCACCCTCGATGGCCAGGAGCAGCACTACCGCAA
CGGCCGCAGCAGCTGGAACCGCTTCGCCTGGCCGGGCACCAGCACCGCGCCGGGCGCGCGCCTGGACGTC
GTCACCCTGAGCGGCACACGGGTCACCGTGTTCGACTTCCCAGGGCGGTGGGGCCTGCTGCGCATGAATG
AGAGCGCTCGGGTCGACGACCTGGACGGCATTCAGCAACGCTTCAGCTGGAACACCGCCAGCGGCCGCGT
AAGCCTTGTCGTGCGCAACTTCGGCGGGGTCAAGCTGACCGATCTGGGTGACGTCAAGGCCCTGAGCGCC
CTCAACAGCAGGGGCGCGCAATGA
 Primer design