SecReT6
Protein ID: 26989811
SecReT6 ID14
T6SS typei4b
Gene symbol-
Locus tagPP_3092
StrainPseudomonas putida KT2440
Repliconchromosome [GenBank: NC_002947] [Browse all T6SS(s) in this replicon]
Location [Strand]3485951..3486667 [-]
Producthypothetical protein
NoteTssL
UniProt IDQ88IA7
KEGG IDppu:PP_3092
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.80E-53, Aligned region: 19..221
Protein Sequence: 238 a.a.     [Download]
>gi|26989811|ref|NP_745236.1| unnamed protein product [Pseudomonas putida KT2440]
MTEAVLQQGAVPAASDKPTLKDLVQDFISMALIVRRGRQVTSVQAFEGSVERFFANLERDARAANYSVEQ
VKDTQYALCAFLDESVLRSDDNALRRHFELQPLQFRYFGVHLAGEGFFEKVDALRADVKQNIDVLEVYHL
CLALGFEGKFSLGQKDQLRYLANTLGQDIARYRKAPKALSPDWALPDQVSQMLRHEVPLWVYLALIALVC
VAVYLTLDWLLGKDVAALSEQIRQLFSA
 
Nucleotide Sequence: 717 bp     [Download]
>gi|26986745|ref|NC_002947.3|:c3486667-3485951 Pseudomonas putida KT2440 chromosome, complete genome
ATGACCGAAGCCGTACTGCAACAGGGCGCCGTCCCGGCCGCCAGCGACAAACCGACGCTCAAGGACCTGG
TCCAGGACTTCATCAGCATGGCGTTGATCGTACGTCGCGGCCGCCAGGTCACCTCGGTGCAGGCCTTCGA
AGGTAGCGTCGAACGCTTCTTCGCCAACCTGGAACGTGATGCCCGTGCCGCCAACTACAGCGTCGAGCAG
GTCAAGGACACCCAATACGCGTTGTGCGCCTTCCTCGACGAAAGCGTCCTGCGCTCGGACGACAATGCGC
TGCGTCGGCACTTTGAGCTGCAGCCGTTGCAGTTCCGCTATTTCGGCGTGCACCTGGCCGGCGAAGGCTT
CTTCGAGAAGGTCGATGCGCTGCGCGCCGACGTCAAGCAGAACATCGACGTGCTCGAGGTTTACCACCTG
TGCCTGGCACTGGGCTTCGAGGGCAAGTTCAGCCTCGGCCAAAAGGACCAGCTGCGTTACCTGGCCAATA
CACTGGGCCAGGATATCGCCCGCTACCGCAAGGCGCCCAAAGCCCTGTCACCGGACTGGGCACTGCCCGA
CCAGGTGTCGCAGATGCTGCGCCATGAAGTACCGCTGTGGGTGTATCTGGCGCTTATCGCGTTGGTCTGC
GTCGCCGTGTACCTGACGCTGGACTGGTTGCTTGGCAAGGACGTCGCCGCCCTGTCCGAACAAATCCGCC
AGCTGTTCAGTGCCTGA
 Primer design