SecReT6
Protein ID: 26989812
SecReT6 ID14
T6SS typei4b
Gene symbol-
Locus tagPP_3093
StrainPseudomonas putida KT2440
Repliconchromosome [GenBank: NC_002947] [Browse all T6SS(s) in this replicon]
Location [Strand]3486664..3488007 [-]
Producthypothetical protein
NoteTssK
UniProt IDQ88IA6
KEGG IDppu:PP_3093
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.60E-137, Aligned region: 19..445
Protein Sequence: 447 a.a.     [Download]
>gi|26989812|ref|NP_745237.1| unnamed protein product [Pseudomonas putida KT2440]
MSKQSRVMWSEGMFLLPQHFQYQDEFHQHQLAEATLRSTPFHWGVQALQVDEDALANGSLQLKRLKLVFP
DGSLYDAPQHDPLPAARDLKDLLKANDLKVYAALKLPEPFGLNYVEDGHEHKAARRFRKQFDTLPDLNEG
ELENEITSLRLNVVLLVDGDSLDGYSHCPLAKLTRNSMGGFNLDPHFVHPTLHLGSHETIAGIGKRLLGA
LQAKSKALSGRRRERADQIAEFGSSDVTLFWLLNTVNRAHPQLAHLLAHPRLHPERLYLFLADLAGGLLT
FTLDTQLSDIPEYDHHDPAASLVKLDEMIRVMLDNVVPNQCIVINLTQTKPSHWQGQLHDPRLAEADFYI
AVHADMPGASLLELVPRAFKVGSPEDIEVVVNSAMPGVTLNHAARLPNAIPVRLDNQYFAIEPHGTVYER
MISAQAICFYAPSAFTNLKLELMAVLK
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|26986745|ref|NC_002947.3|:c3488007-3486664 Pseudomonas putida KT2440 chromosome, complete genome
ATGAGCAAGCAGAGCCGGGTGATGTGGTCGGAAGGCATGTTCCTGCTGCCCCAGCACTTCCAGTATCAGG
ACGAATTCCATCAGCACCAGTTGGCTGAGGCGACCCTGCGCAGCACCCCTTTCCATTGGGGGGTTCAGGC
GTTGCAGGTGGACGAGGACGCCCTGGCCAATGGTTCACTGCAGCTCAAGCGCCTGAAGCTGGTGTTCCCC
GATGGCAGCCTCTACGACGCGCCGCAGCACGATCCGCTGCCGGCCGCGCGCGACCTCAAGGACCTGCTCA
AGGCCAACGACCTGAAGGTCTATGCTGCGCTCAAGCTGCCCGAGCCATTCGGCCTCAACTACGTCGAGGA
TGGCCACGAACACAAGGCCGCACGGCGTTTCCGCAAGCAGTTCGACACCCTGCCCGACCTTAATGAAGGC
GAGCTGGAGAACGAAATCACCAGCTTGCGCCTGAACGTCGTACTGCTGGTCGACGGTGACAGCCTCGACG
GTTACAGCCACTGCCCTCTGGCCAAGCTGACACGCAACAGCATGGGCGGTTTCAACCTTGACCCGCATTT
CGTCCACCCCACCTTGCACCTGGGCAGCCACGAGACCATTGCCGGCATCGGCAAACGCCTGCTCGGCGCC
CTGCAGGCCAAGAGCAAGGCGCTTTCCGGCCGGCGCCGCGAGCGCGCCGACCAGATCGCCGAGTTCGGCT
CCAGCGATGTAACCCTGTTCTGGCTGCTGAACACGGTCAACCGTGCCCACCCGCAGCTGGCTCATCTACT
GGCCCACCCGCGCCTGCACCCAGAGCGCCTGTACCTGTTCCTGGCCGACCTTGCCGGCGGCCTGCTGACC
TTCACCCTGGACACCCAGCTCAGCGACATCCCCGAGTACGACCACCACGACCCGGCCGCGTCGCTGGTCA
AGCTCGACGAAATGATCCGGGTGATGCTCGACAACGTCGTGCCCAACCAGTGCATTGTCATCAACCTGAC
CCAGACCAAGCCATCGCACTGGCAAGGCCAACTGCACGACCCGCGCCTGGCCGAAGCCGACTTCTATATC
GCCGTGCACGCCGACATGCCCGGCGCCAGCCTGCTGGAGCTGGTGCCCCGTGCCTTCAAGGTCGGTTCGC
CGGAAGACATTGAAGTGGTGGTCAACAGCGCCATGCCGGGTGTCACCCTCAATCATGCCGCGCGGCTGCC
GAACGCGATTCCGGTGCGCCTGGACAACCAGTACTTCGCCATCGAGCCACACGGCACTGTGTATGAGCGA
ATGATCAGCGCCCAGGCCATCTGCTTCTATGCGCCCAGCGCCTTTACCAACCTCAAGCTTGAACTGATGG
CGGTGCTCAAATGA
 Primer design