SecReT6
Protein ID: 26989813
SecReT6 ID14
T6SS typei4b
Gene symbol-
Locus tagPP_3094
StrainPseudomonas putida KT2440
Repliconchromosome [GenBank: NC_002947] [Browse all T6SS(s) in this replicon]
Location [Strand]3488004..3488726 [-]
Producthypothetical protein
NoteTssJ
UniProt IDQ88IA5
KEGG IDppu:PP_3094
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.60E-35, Aligned region: 18..172
Protein Sequence: 240 a.a.     [Download]
>gi|26989813|ref|NP_745238.1| unnamed protein product [Pseudomonas putida KT2440]
MQHKHIVLKRLTAAALLVALAGCGVTDRIGKRMEDSWAADMLADSEKVILTSDGGNQLNPDAEGKPLSVV
MRVYQLTDLERFAATDAETLWDAPQKALGNTLVETREITLLPGIGQIDQWPLAKNARYVGVAAFFRDEQD
ARWKVAFDANSLRKDGIWFSSDGLRVLVDNTEISAMRGVDVLNKPPTADQLAAAQKAKDADATLTDKVQD
AAIDKATDAASQSASNAMDSTFNSLVDSVK
 
Nucleotide Sequence: 723 bp     [Download]
>gi|26986745|ref|NC_002947.3|:c3488726-3488004 Pseudomonas putida KT2440 chromosome, complete genome
ATGCAACACAAGCACATCGTCCTCAAACGCCTGACCGCAGCCGCCTTGCTGGTAGCGCTGGCCGGCTGCG
GGGTCACCGACCGTATCGGCAAGCGCATGGAAGACAGCTGGGCGGCCGACATGCTGGCCGACAGCGAAAA
GGTCATCCTGACCTCCGACGGCGGCAACCAGCTCAACCCCGACGCCGAGGGCAAGCCGCTGTCGGTGGTG
ATGCGCGTGTATCAGCTGACCGACCTCGAGCGCTTCGCGGCTACCGATGCCGAGACCCTGTGGGACGCCC
CGCAAAAAGCCTTGGGCAACACCCTGGTGGAAACCCGCGAGATCACCCTGCTGCCCGGCATTGGCCAGAT
CGACCAGTGGCCGCTGGCCAAGAACGCGCGCTACGTCGGCGTGGCGGCGTTCTTCCGCGATGAGCAGGAC
GCGCGCTGGAAAGTCGCCTTCGACGCCAACTCGCTGCGCAAGGACGGTATCTGGTTCTCCTCCGACGGCC
TGCGGGTACTGGTGGACAACACCGAAATCAGCGCCATGCGGGGCGTGGACGTACTGAACAAACCGCCGAC
CGCCGACCAGCTTGCCGCTGCGCAGAAGGCCAAGGATGCCGACGCGACCCTCACCGACAAGGTGCAGGAC
GCGGCCATCGACAAAGCCACCGACGCCGCCAGCCAGTCGGCCAGCAACGCCATGGATTCAACCTTCAACT
CTTTAGTGGATAGCGTCAAATGA
 Primer design