SecReT6
Protein ID: 26989814
SecReT6 ID14
T6SS typei4b
Gene symbol-
Locus tagPP_3095
StrainPseudomonas putida KT2440
Repliconchromosome [GenBank: NC_002947] [Browse all T6SS(s) in this replicon]
Location [Strand]3488751..3491387 [-]
Productchaperone-associated ATPase
NoteTssH
UniProt IDQ88IA4
KEGG IDppu:PP_3095
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 4.70E-44, Aligned region: 238..258
AAA_2 [PF07724], Evalue: 4.70E-44, Aligned region: 609..776
AAA_2 [PF07724], Evalue: 4.70E-44, Aligned region: 830..850
AAA [PF00004], Evalue: 5.00E-19, Aligned region: 74..92
AAA [PF00004], Evalue: 5.00E-19, Aligned region: 238..351
AAA [PF00004], Evalue: 5.00E-19, Aligned region: 514..529
AAA [PF00004], Evalue: 5.00E-19, Aligned region: 615..733
ClpB_D2-small [PF10431], Evalue: 4.80E-14, Aligned region: 785..856
AAA_5 [PF07728], Evalue: 1.20E-13, Aligned region: 238..260
AAA_5 [PF07728], Evalue: 1.20E-13, Aligned region: 400..463
AAA_5 [PF07728], Evalue: 1.20E-13, Aligned region: 614..735
AAA_22 [PF13401], Evalue: 3.50E-09, Aligned region: 237..324
AAA_22 [PF13401], Evalue: 3.50E-09, Aligned region: 355..432
AAA_22 [PF13401], Evalue: 3.50E-09, Aligned region: 612..651
AAA_22 [PF13401], Evalue: 3.50E-09, Aligned region: 727..764
Clp_N [PF02861], Evalue: 2.40E-08, Aligned region: 34..86
Clp_N [PF02861], Evalue: 2.40E-08, Aligned region: 116..137
AAA_16 [PF13191], Evalue: 5.30E-08, Aligned region: 128..165
AAA_16 [PF13191], Evalue: 5.30E-08, Aligned region: 215..261
AAA_16 [PF13191], Evalue: 5.30E-08, Aligned region: 282..316
AAA_16 [PF13191], Evalue: 5.30E-08, Aligned region: 456..540
AAA_16 [PF13191], Evalue: 5.30E-08, Aligned region: 609..655
AAA_16 [PF13191], Evalue: 5.30E-08, Aligned region: 679..703
AAA_16 [PF13191], Evalue: 5.30E-08, Aligned region: 801..816
Sigma54_activat [PF00158], Evalue: 6.50E-07, Aligned region: 234..271
Sigma54_activat [PF00158], Evalue: 6.50E-07, Aligned region: 614..740
Arch_ATPase [PF01637], Evalue: 1.70E-06, Aligned region: 217..252
Arch_ATPase [PF01637], Evalue: 1.70E-06, Aligned region: 291..392
Arch_ATPase [PF01637], Evalue: 1.70E-06, Aligned region: 613..655
Arch_ATPase [PF01637], Evalue: 1.70E-06, Aligned region: 680..708
AAA_19 [PF13245], Evalue: 4.80E-06, Aligned region: 238..259
AAA_19 [PF13245], Evalue: 4.80E-06, Aligned region: 612..636
NACHT [PF05729], Evalue: 8.70E-06, Aligned region: 238..267
NACHT [PF05729], Evalue: 8.70E-06, Aligned region: 614..639
NACHT [PF05729], Evalue: 8.70E-06, Aligned region: 722..762
AAA_17 [PF13207], Evalue: 9.20E-06, Aligned region: 238..332
AAA_17 [PF13207], Evalue: 9.20E-06, Aligned region: 615..652
AAA_14 [PF13173], Evalue: 4.30E-05, Aligned region: 238..371
AAA_14 [PF13173], Evalue: 4.30E-05, Aligned region: 613..695
IstB_IS21 [PF01695], Evalue: 6.30E-05, Aligned region: 232..260
IstB_IS21 [PF01695], Evalue: 6.30E-05, Aligned region: 614..633
Zeta_toxin [PF06414], Evalue: 0.00042, Aligned region: 151..181
Zeta_toxin [PF06414], Evalue: 0.00042, Aligned region: 233..262
Zeta_toxin [PF06414], Evalue: 0.00042, Aligned region: 608..654
AAA_18 [PF13238], Evalue: 0.00052, Aligned region: 238..280
AAA_18 [PF13238], Evalue: 0.00052, Aligned region: 616..639
AAA_23 [PF13476], Evalue: 0.00061, Aligned region: 238..254
AAA_23 [PF13476], Evalue: 0.00061, Aligned region: 470..514
AAA_23 [PF13476], Evalue: 0.00061, Aligned region: 612..712
AAA_29 [PF13555], Evalue: 0.00097, Aligned region: 231..254
AAA_29 [PF13555], Evalue: 0.00097, Aligned region: 612..639
AAA_25 [PF13481], Evalue: 0.0023, Aligned region: 238..299
AAA_25 [PF13481], Evalue: 0.0023, Aligned region: 363..393
AAA_25 [PF13481], Evalue: 0.0023, Aligned region: 488..528
AAA_25 [PF13481], Evalue: 0.0023, Aligned region: 612..638
RNA_helicase [PF00910], Evalue: 0.0094, Aligned region: 239..259
RNA_helicase [PF00910], Evalue: 0.0094, Aligned region: 615..636
RNA_helicase [PF00910], Evalue: 0.0094, Aligned region: 715..733
Protein Sequence: 878 a.a.     [Download]
>gi|26989814|ref|NP_745239.1| unnamed protein product [Pseudomonas putida KT2440]
MRRLPHSLRWGRLVNLKSLFAKLNETSRTATESAAALCLSEHHYEVEVEHLLLQLLDNNDSDLAPILRHY
QVVAERLQAQLVTALGTFKKGNTRTPALSPHITRMIEQAWLLASIEYGVGQVRSAHLLQALLDDAELRRV
VIASAPELEKINADDLRLNLAALVEGSAESRQASPLASPAAPVSTSSKASGKTPALDQYTVNLTQSAREG
RIDPVLGREFEVRQMVDILTRRRQNNPILTGEAGVGKTAVVEGLALRIAQGDVPAVLKDVALHTLDLGLL
QAGAGVKGEFENRLKAVIEEVKRSLHPIILFIDEAHTLIGSGGQAGQNDAANLLKPALARGELRTIAATT
WAEYKKYFEKDAALARRFQVVKVEEPDEDKAIHMLRGLLGKMREHHKVAVMDEALVQAVRLSNRYITGRQ
LPDKAVSVLDTACARIALAQSSLPGALEDCRRQIDNLQAEIDVLGHEAGKGHDHARRLESLQAALQAEQQ
QEQQLNAQWQQELELVEQLKALDAANDADAQQLNTLRAELARVQGDQPLVHALVDSGAIAQVISGWTGIP
LGKMLRDEIDTVQRLPALLGERVLGQDHALHEIGKRIKISRARMEDPNKPIGVFLLLGPSGVGKTETALA
LADTLYGGERNLITINMSEYQEAHTVSSLKGSPPGYVGYGEGGVLTEAVRRKPYSVVLLDEVEKAHPDVL
ELFFQVFDKGVLDDGEGREINFRNTVIILTSNTGTERIMQTCLNATELPTPEAIVEDLRDQLNHVFKPAF
LGRLSIVPFYPVQDQILERIVALKLERIAKRFARNHQAELSYDQALVKAIAARCTEVDSGARNIDNILSQ
TLMPELAQRVLERMAQDAPIQHLAIELGSDGDFAYRLA
 
Nucleotide Sequence: 2637 bp     [Download]
>gi|26986745|ref|NC_002947.3|:c3491387-3488751 Pseudomonas putida KT2440 chromosome, complete genome
TTGCGCCGTCTTCCACATTCCTTACGATGGGGTCGCCTTGTGAACCTGAAGTCTCTGTTCGCCAAGCTCA
ACGAAACCAGCCGCACGGCCACCGAAAGCGCGGCGGCCCTGTGCCTGTCGGAGCACCATTACGAGGTGGA
AGTGGAGCACCTGCTGCTGCAGTTGCTCGACAACAACGACAGCGACCTGGCGCCGATCCTGCGCCACTAC
CAGGTCGTCGCCGAACGCCTGCAAGCGCAGCTGGTCACCGCCCTGGGCACCTTCAAGAAAGGTAATACCC
GCACCCCGGCGCTGTCGCCGCACATTACCCGCATGATCGAGCAAGCCTGGTTGCTGGCCTCGATCGAATA
CGGCGTAGGCCAGGTGCGCAGCGCTCACCTGCTGCAGGCTCTGCTTGACGATGCTGAACTGCGTCGCGTG
GTGATCGCCTCGGCACCGGAGCTGGAAAAAATCAACGCCGATGACCTGCGCCTGAACCTTGCCGCGCTGG
TGGAGGGTAGCGCCGAGTCCAGGCAGGCCAGCCCGCTGGCCAGCCCAGCGGCGCCAGTGAGCACGTCGAG
CAAGGCCAGCGGCAAGACCCCGGCGCTGGACCAGTACACGGTCAACCTTACCCAAAGCGCCCGCGAAGGC
CGCATCGACCCGGTGCTGGGCCGTGAGTTCGAAGTACGGCAGATGGTCGACATCCTCACCCGCCGCCGGC
AGAACAACCCGATCCTCACGGGCGAAGCCGGGGTCGGCAAAACCGCCGTGGTCGAAGGCCTGGCGCTGCG
CATCGCCCAGGGTGACGTGCCGGCGGTGCTCAAGGACGTTGCCCTGCACACCCTCGACCTGGGCCTGTTA
CAGGCCGGCGCCGGGGTCAAGGGCGAGTTCGAGAACCGCCTCAAGGCTGTGATCGAAGAGGTCAAGCGCA
GCCTGCACCCGATCATCCTGTTCATCGACGAAGCCCACACCCTGATCGGCTCCGGCGGCCAGGCCGGGCA
GAACGATGCCGCCAACCTGCTCAAGCCGGCCCTGGCCCGTGGCGAGTTGCGCACCATCGCTGCCACTACC
TGGGCCGAATACAAGAAGTACTTCGAGAAGGACGCCGCCCTCGCCCGCCGCTTCCAGGTGGTCAAAGTGG
AAGAGCCCGACGAAGACAAGGCCATTCACATGCTGCGCGGCCTGCTCGGCAAGATGCGCGAGCACCACAA
GGTGGCGGTGATGGACGAAGCGCTGGTGCAGGCGGTACGCCTGTCCAACCGCTACATCACCGGCCGCCAG
CTGCCCGACAAGGCGGTCAGCGTGCTCGACACGGCCTGCGCGCGCATTGCCCTGGCGCAATCTTCGCTGC
CCGGCGCACTGGAAGACTGCCGCCGGCAGATCGACAACCTGCAGGCGGAAATCGACGTGCTCGGCCACGA
AGCCGGCAAGGGGCACGACCATGCCCGCCGCCTGGAATCGCTGCAGGCTGCCCTGCAGGCCGAGCAGCAG
CAGGAACAGCAGCTCAATGCCCAGTGGCAGCAGGAGCTGGAACTGGTCGAACAGCTCAAGGCGCTGGACG
CCGCCAACGATGCCGACGCCCAGCAGCTCAATACCCTGCGTGCCGAGCTGGCGCGCGTGCAAGGCGACCA
GCCACTGGTCCACGCGCTGGTCGACAGCGGCGCCATCGCCCAGGTCATCAGTGGCTGGACCGGCATCCCG
CTGGGCAAGATGCTGCGTGACGAAATCGATACCGTGCAGCGCCTGCCGGCCCTGCTTGGTGAGCGCGTGC
TGGGCCAGGACCACGCCCTGCATGAGATCGGCAAGCGCATCAAGATTTCCCGAGCGCGCATGGAAGACCC
GAACAAACCGATTGGCGTGTTCCTGCTGCTCGGCCCCAGCGGCGTCGGCAAGACCGAAACCGCCCTGGCC
CTGGCCGACACCTTGTACGGCGGCGAGCGCAACCTGATCACCATCAACATGTCCGAGTACCAGGAAGCCC
ACACCGTGTCGAGCCTCAAGGGCTCGCCACCCGGCTATGTCGGCTACGGCGAAGGCGGCGTACTGACCGA
GGCGGTGCGCCGCAAGCCGTACAGCGTGGTGTTGCTCGACGAGGTGGAAAAAGCCCACCCCGACGTGCTC
GAACTGTTCTTCCAGGTGTTCGACAAGGGCGTGCTGGACGATGGCGAAGGCCGCGAGATCAACTTCCGCA
ACACGGTGATCATCCTCACCTCCAACACCGGCACCGAGCGCATCATGCAGACCTGCCTGAACGCCACCGA
GCTGCCGACGCCCGAGGCGATCGTCGAAGACCTGCGCGACCAGCTCAACCATGTGTTCAAGCCGGCCTTC
CTCGGTCGCCTGAGCATCGTGCCGTTCTACCCGGTGCAGGACCAGATCCTCGAGCGCATCGTCGCCCTCA
AGCTCGAACGCATCGCCAAGCGCTTCGCCCGCAACCACCAGGCCGAGCTCAGCTATGACCAGGCGCTGGT
CAAGGCCATCGCCGCGCGCTGCACCGAGGTCGACAGCGGCGCACGCAACATCGACAACATCCTGTCCCAG
ACCCTGATGCCCGAACTCGCCCAGCGCGTGCTCGAGCGCATGGCCCAGGACGCGCCGATCCAGCACCTTG
CGATCGAGCTGGGCAGCGATGGCGATTTCGCCTATCGCCTGGCCTGA
 Primer design