SecReT6
Protein ID: 26989815
SecReT6 ID14
T6SS typei4b
Gene symbol-
Locus tagPP_3096
StrainPseudomonas putida KT2440
Repliconchromosome [GenBank: NC_002947] [Browse all T6SS(s) in this replicon]
Location [Strand]3491345..3492415 [-]
Producthypothetical protein
NoteTssG
UniProt IDQ88IA3
KEGG IDppu:PP_3096
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.10E-103, Aligned region: 17..333
Protein Sequence: 356 a.a.     [Download]
>gi|26989815|ref|NP_745240.1| unnamed protein product [Pseudomonas putida KT2440]
MASTHRRSAPGLIDQARAEPHRFEFFQLVRLLRLHYSRTGRMDLATRPHEDPLRFRTQLSLAFPASEVSD
LHFEREGKVSPAGLPLSEVQVTFMGLVGPSGVLPRPYTELLLERHVQYRDDAAHAFLDIFSHRMTTLFYE
AWQKYKFHIEHERNGTSGFDGYLLNLVGLGPRAQKLKFEEQPSALRRELFSYFAGLLSQKPRNALNLERM
LGFYFSLPIKVQPFAGRWLHLQPEQCTQLGRRNAQLGHSAVAGNRVWDYQSCIRIELGPLSLADYQRFQP
GTACYRKLVELVRFYIGAELDFEIAPRLKREAVPRAQLGRSGNVALGWLGWLKRPGRDAEPSRCAVFHIP
YDGVAL
 
Nucleotide Sequence: 1071 bp     [Download]
>gi|26986745|ref|NC_002947.3|:c3492415-3491345 Pseudomonas putida KT2440 chromosome, complete genome
ATGGCCAGCACGCACCGGCGATCAGCCCCTGGTCTGATCGATCAGGCCCGAGCCGAGCCGCACCGATTCG
AATTCTTTCAATTGGTGCGCCTGCTCCGCCTGCACTACAGCCGCACCGGGCGCATGGACCTGGCAACCCG
GCCGCACGAAGACCCGCTGCGTTTTCGTACCCAGCTGTCGCTGGCGTTCCCGGCCAGCGAGGTCAGCGAC
CTGCACTTCGAGCGCGAAGGCAAGGTGTCGCCGGCCGGCTTGCCGCTGTCGGAAGTGCAGGTCACCTTCA
TGGGCCTGGTCGGGCCGTCGGGCGTGCTGCCACGCCCGTACACCGAGCTGCTGCTCGAGCGCCACGTGCA
GTATCGCGACGATGCCGCCCATGCGTTTCTCGACATCTTCTCGCACCGCATGACCACGTTGTTCTACGAG
GCCTGGCAAAAATACAAATTCCACATCGAGCACGAGCGCAATGGCACCTCGGGCTTCGATGGCTACCTGC
TCAACCTGGTTGGCCTCGGGCCGCGCGCCCAGAAGCTGAAGTTCGAAGAGCAACCGTCAGCATTGCGTCG
TGAGCTGTTCAGCTATTTTGCCGGCCTGCTCAGCCAGAAGCCGCGCAATGCGCTGAACCTTGAACGCATG
CTCGGCTTCTACTTCTCGCTGCCGATCAAGGTACAGCCGTTCGCCGGGCGCTGGCTGCACCTGCAGCCCG
AACAATGCACCCAGCTCGGCCGCCGCAATGCCCAGCTCGGCCACAGCGCCGTCGCCGGCAACCGGGTCTG
GGACTACCAGTCGTGCATCCGCATCGAGCTGGGCCCGCTCAGCCTGGCCGACTACCAGCGCTTCCAGCCG
GGCACCGCCTGCTACCGCAAGCTGGTCGAGTTGGTGCGCTTCTATATAGGTGCCGAACTGGATTTCGAAA
TTGCCCCGCGCCTCAAGCGCGAGGCGGTACCACGCGCCCAACTGGGCCGCAGCGGCAATGTCGCCCTGGG
CTGGCTGGGTTGGCTCAAACGCCCTGGTCGTGACGCGGAGCCTTCGCGTTGCGCCGTCTTCCACATTCCT
TACGATGGGGTCGCCTTGTGA
 Primer design