SecReT6
Protein ID: 26989816
SecReT6 ID14
T6SS typei4b
Gene symbol-
Locus tagPP_3097
StrainPseudomonas putida KT2440
Repliconchromosome [GenBank: NC_002947] [Browse all T6SS(s) in this replicon]
Location [Strand]3492379..3494199 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ88IA2
KEGG IDppu:PP_3097
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 9.70E-212, Aligned region: 5..606
Protein Sequence: 606 a.a.     [Download]
>gi|26989816|ref|NP_745241.1| unnamed protein product [Pseudomonas putida KT2440]
MLDELLPYYEKELSHLRFLGQEFAAQYPKIASRLLIEGDNCEDPHTERLIEAFSFLSARVHKKLDDEFPE
IVESFLEVLYPHYLRPTPSMSIVELSLGRHEKVTEAYRVARHTEMHANPVEGVVCKFRTCYPVELWPIAV
QQASFTEMERSAFNGHSADLVARLRIRLAATGDALFGQMDMNRLRFFLDGEATLMLQLYELLFNNLAKAT
LSFDDQGRSREVALPADALKTVGYARDEGLVDYSERSFLGYRLLHEYFTFPDKFMFFDLSGFARILQGKA
IEQVEVNFYFSDYDLSERLARLTQNIGRNNFKLNCTPIINLFRQQAEPIKLTHTQHEYQVTPDTRLHNAA
EVVSIDRVRRVRKLGGIDQVATCQPFFEPRGEQDPHSSFWVARRRNQGDATAMSIRVVDRDLELIDASSD
TLSIGLTCSNRDVPLMLPFGGERGDFTIPANSVIKDIRCLRKPTATVRVPLGKGLIWRLIAHLSLNHLSL
VSQGREVLLELLSLYNYRNVSAIRKQINGIKAISSEPVVARIGHPRPNFVRGVGITLTLDESQFIGSGVF
LFGRVLDHFFGQYCSMNSFTQLTLRTQQREKRVVQWPARTGDQPLV
 
Nucleotide Sequence: 1821 bp     [Download]
>gi|26986745|ref|NC_002947.3|:c3494199-3492379 Pseudomonas putida KT2440 chromosome, complete genome
ATGCTCGACGAACTGCTGCCCTACTACGAAAAGGAACTGTCGCACCTGCGCTTTCTCGGCCAAGAGTTTG
CTGCGCAGTACCCGAAGATCGCTTCGCGGTTGCTGATCGAGGGCGACAACTGCGAAGACCCGCACACCGA
GCGCCTGATCGAGGCGTTCTCGTTCCTGTCTGCGCGGGTGCACAAGAAGCTCGATGACGAGTTTCCGGAA
ATCGTCGAATCCTTCCTCGAGGTACTGTACCCCCACTACCTGCGCCCTACTCCGTCGATGTCGATTGTCG
AACTGAGCCTGGGCAGGCACGAAAAAGTCACCGAAGCCTACCGCGTCGCGCGCCATACCGAGATGCATGC
CAATCCCGTGGAAGGCGTGGTGTGCAAGTTCCGCACCTGCTACCCGGTAGAGCTGTGGCCGATTGCCGTG
CAGCAGGCCTCGTTCACAGAAATGGAACGCTCGGCCTTCAACGGGCACAGCGCCGACCTGGTCGCTCGTC
TGCGCATCCGCCTGGCAGCCACTGGCGATGCCCTGTTCGGGCAGATGGACATGAACCGCCTGCGGTTCTT
CCTCGACGGCGAAGCGACCCTGATGCTGCAGCTGTACGAACTGCTGTTCAACAACCTCGCCAAGGCCACG
CTGAGCTTCGACGACCAGGGCCGCAGCCGCGAGGTGGCGCTGCCGGCCGATGCCCTGAAAACCGTGGGCT
ATGCCCGTGACGAAGGCCTGGTGGATTACTCCGAACGCTCATTCCTGGGCTACCGCCTGCTGCACGAGTA
TTTCACCTTCCCTGACAAGTTCATGTTCTTCGACCTCAGTGGATTTGCCCGCATCCTGCAGGGCAAGGCC
ATCGAGCAGGTAGAGGTCAACTTCTATTTCTCCGACTACGACCTCAGCGAGCGCCTGGCGCGGCTGACCC
AGAACATCGGGCGCAACAACTTCAAGCTCAACTGCACGCCGATCATCAACCTGTTCCGCCAGCAGGCCGA
GCCAATCAAGCTGACCCACACCCAGCACGAATACCAGGTCACCCCTGACACACGGCTGCACAACGCTGCA
GAAGTGGTATCGATCGACCGGGTACGGCGGGTGCGCAAACTCGGCGGTATCGACCAGGTCGCCACCTGCC
AGCCGTTTTTCGAACCCCGGGGCGAGCAAGACCCACACAGCAGCTTCTGGGTTGCGCGCCGGCGAAACCA
GGGTGACGCCACTGCCATGAGCATCCGCGTGGTCGACCGCGATCTGGAACTGATCGACGCCAGCAGCGAC
ACCCTCAGTATCGGCCTTACCTGCAGCAACCGCGACGTGCCGCTGATGCTGCCGTTCGGTGGCGAACGGG
GCGATTTCACCATTCCCGCCAACTCGGTGATCAAGGATATCCGCTGCCTGCGCAAGCCCACCGCCACGGT
GCGTGTGCCCTTGGGCAAGGGCCTGATCTGGCGGTTGATCGCCCACCTGTCGCTGAACCATCTGTCGCTG
GTCAGCCAGGGCCGCGAAGTGCTGCTGGAGCTGTTGTCGCTGTACAACTACCGCAATGTCTCCGCCATTC
GCAAACAGATCAACGGCATCAAGGCGATCAGCAGCGAGCCGGTGGTCGCGCGCATCGGCCACCCGCGGCC
AAATTTCGTGCGCGGCGTCGGCATCACCCTGACCCTGGACGAAAGCCAGTTCATCGGCAGCGGCGTGTTT
CTGTTCGGCAGGGTGCTGGACCACTTCTTCGGCCAGTACTGCTCGATGAACAGTTTCACCCAACTGACCC
TGCGCACCCAACAACGAGAAAAGAGAGTCGTACAATGGCCAGCACGCACCGGCGATCAGCCCCTGGTCTG
A
 Primer design