SecReT6
Protein ID: 26989817
SecReT6 ID14
T6SS typei4b
Gene symbol-
Locus tagPP_3098
StrainPseudomonas putida KT2440
Repliconchromosome [GenBank: NC_002947] [Browse all T6SS(s) in this replicon]
Location [Strand]3494199..3494681 [-]
Producthypothetical protein
NoteTssE
UniProt IDQ88IA1
KEGG IDppu:PP_3098
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.00E-18, Aligned region: 34..136
Protein Sequence: 160 a.a.     [Download]
>gi|26989817|ref|NP_745242.1| unnamed protein product [Pseudomonas putida KT2440]
MSNQARLLPSLLDRLLDDRPYQSAEPAAQRTCSLAEYKASIVRDLEVLVNTRQSLVAEELDGFSQLGGSI
LEYGMPDFISRSVLDPHDRRLIQQQLERAISTGDRRFRRVRVQLLAQQNGHRMLTFRVDAVLRLQDISRQ
VSFDAVLQVNTQEYKVQNLN
 
Nucleotide Sequence: 483 bp     [Download]
>gi|26986745|ref|NC_002947.3|:c3494681-3494199 Pseudomonas putida KT2440 chromosome, complete genome
ATGAGTAACCAGGCCCGCCTGCTGCCCTCGCTGCTCGACCGACTGCTGGACGATCGTCCCTACCAGTCGG
CCGAGCCCGCAGCGCAGCGCACCTGCTCGCTGGCCGAGTACAAGGCCAGCATCGTCCGCGACCTCGAAGT
CCTGGTGAACACCCGCCAGTCCCTGGTCGCCGAAGAGCTCGACGGTTTCAGCCAGCTCGGTGGTTCCATC
CTTGAATACGGCATGCCGGACTTCATCAGCCGCAGCGTGCTCGACCCGCACGATCGTCGCCTGATCCAGC
AACAGCTGGAGCGGGCGATCAGCACCGGAGACCGGCGCTTTCGCCGGGTCCGTGTTCAGCTGTTGGCCCA
GCAGAACGGCCACCGCATGTTGACCTTCCGCGTGGACGCCGTGTTGCGTCTGCAGGACATCAGCCGCCAG
GTGTCATTCGACGCCGTGCTGCAGGTCAACACCCAGGAATACAAAGTGCAGAACCTCAACTGA
 Primer design