SecReT6
Protein ID: 26989818
SecReT6 ID14
T6SS typei4b
Gene symbol-
Locus tagPP_3099
StrainPseudomonas putida KT2440
Repliconchromosome [GenBank: NC_002947] [Browse all T6SS(s) in this replicon]
Location [Strand]3494708..3496210 [-]
Producthypothetical protein
NoteTssC
UniProt IDQ88IA0
KEGG IDppu:PP_3099
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.10E-196, Aligned region: 73..495
Protein Sequence: 500 a.a.     [Download]
>gi|26989818|ref|NP_745243.1| unnamed protein product [Pseudomonas putida KT2440]
MTDKQTAPQQAGDLVEVENFAPQPSLLDSIISQSRVARSDTERNRTRDLIGELVNQVLEGEMTPSKDLIA
VLDSRIAEIDAMLSEQMNEIMHAREFQQLEASWRGLKYQVDQTETSTTLKIHLLNASKKDLVRDLKAASE
FDQSALFKKVYEEEYGTFGGAPFGMLIGDYEFNRNPEDMYLLEEISHVAAAAHAPFISAASSELFGWDSF
TEMSGPRDLAKIFDTVEYAKWKSFRASEDSRYVGLTLPHVLGRLPYGPDTTPVEEFNFVESVDGRDHNKY
LWMNAAYALGTRVTDAFARYGWCVAIRGVEGGGLVEGLPTHTFKTDDGEIALKCPTEIAITDRREKELSD
LGFIPLVHCKGTDYAAFFGTQSAQKQKQYNTDIANANARLSAQLQYIFATSRIAHYMKAIMRDKIGSFAS
RMDVERFLNQWLASYVLLDDTASQEAKAKFPLREARAEVFEVPGKPGVYKAVTYLRPHYQLDELTASLRL
VAELPQGARG
 
Nucleotide Sequence: 1503 bp     [Download]
>gi|26986745|ref|NC_002947.3|:c3496210-3494708 Pseudomonas putida KT2440 chromosome, complete genome
ATGACCGACAAGCAAACCGCACCGCAACAGGCCGGCGACCTGGTCGAAGTGGAAAACTTCGCACCACAGC
CCTCGCTGCTCGACAGCATCATTTCGCAAAGCCGCGTGGCCCGCTCCGACACCGAGCGCAACCGCACCCG
CGACCTGATTGGCGAACTGGTGAACCAGGTGCTCGAGGGTGAGATGACCCCGAGCAAGGACCTGATCGCC
GTGCTCGATTCGCGCATCGCCGAGATCGACGCGATGCTCTCCGAGCAGATGAACGAGATCATGCACGCCC
GCGAGTTTCAGCAGTTGGAAGCCTCCTGGCGCGGCCTGAAATACCAGGTAGACCAGACCGAGACCAGCAC
CACGCTGAAGATCCACCTGCTCAATGCCTCGAAGAAAGACCTGGTACGCGACCTGAAGGCCGCCAGCGAA
TTTGACCAGAGCGCACTGTTCAAGAAGGTCTACGAAGAAGAGTACGGCACCTTCGGTGGCGCGCCTTTCG
GCATGTTGATCGGTGACTACGAGTTCAACCGCAACCCTGAAGACATGTACCTGCTCGAAGAGATCTCGCA
CGTCGCGGCGGCGGCGCACGCGCCGTTCATCTCGGCCGCTTCGTCCGAGCTGTTCGGCTGGGACTCGTTC
ACCGAGATGTCCGGCCCGCGTGACCTGGCGAAGATCTTCGACACCGTGGAATACGCCAAGTGGAAGTCGT
TCCGCGCCTCGGAAGACTCGCGTTACGTCGGCCTCACCCTGCCCCACGTGCTCGGTCGCCTGCCGTATGG
ACCGGATACCACCCCGGTGGAAGAATTCAACTTCGTCGAAAGCGTCGATGGCCGCGACCACAACAAGTAC
CTGTGGATGAACGCCGCCTACGCCCTCGGCACCCGGGTCACCGATGCCTTCGCCCGCTACGGCTGGTGCG
TGGCCATCCGCGGCGTGGAAGGTGGCGGCCTGGTCGAAGGCCTGCCGACCCATACCTTCAAGACCGACGA
CGGCGAAATCGCCCTCAAGTGCCCGACCGAAATCGCCATCACCGATCGCCGCGAAAAAGAGCTGTCGGAC
CTGGGCTTCATCCCCCTGGTGCACTGCAAGGGCACCGACTATGCCGCGTTCTTCGGCACCCAGTCGGCGC
AGAAACAGAAGCAGTACAACACCGACATCGCCAACGCCAACGCACGCCTGTCGGCCCAGCTGCAATACAT
CTTCGCCACTTCGCGCATCGCCCACTACATGAAGGCGATCATGCGCGACAAGATCGGCAGCTTCGCCTCG
CGCATGGATGTCGAGCGCTTCCTCAACCAGTGGCTGGCCAGCTACGTGCTGCTCGACGATACCGCCAGCC
AGGAGGCCAAGGCCAAGTTCCCGCTGCGCGAAGCCCGCGCCGAGGTGTTCGAAGTGCCCGGCAAGCCAGG
CGTGTACAAGGCCGTGACCTACTTGCGCCCGCACTACCAGCTGGATGAGCTGACCGCCTCGCTGCGGCTG
GTTGCCGAGCTGCCACAGGGCGCGCGCGGCTGA
 Primer design