SecReT6
Protein ID: 26989819
SecReT6 ID14
T6SS typei4b
Gene symbol-
Locus tagPP_3100
StrainPseudomonas putida KT2440
Repliconchromosome [GenBank: NC_002947] [Browse all T6SS(s) in this replicon]
Location [Strand]3496225..3496800 [-]
Producthypothetical protein
NoteTssB
UniProt IDQ88I99
KEGG IDppu:PP_3100
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 9.50E-61, Aligned region: 2..25
DUF770 [PF05591], Evalue: 9.50E-61, Aligned region: 23..177
Protein Sequence: 191 a.a.     [Download]
>gi|26989819|ref|NP_745244.1| unnamed protein product [Pseudomonas putida KT2440]
MIRSELLALENTMAKKESTQHKLDRVRAPRVHITYDVDIGDAIEKKELPFVVGVLGDFSGNPPEPLPKLK
DRKFVYIDRDNFNGVLKGIKPRLTYRVDNTLAKNGTQLGVELNFNSLEDFEPQNVVKQVEPLRKLLEVRN
KLADLRNKMGGNDKLEELLMDVLQNTEKLKTLGKEFGREAEVKDPSSDDRA
 
Nucleotide Sequence: 576 bp     [Download]
>gi|26986745|ref|NC_002947.3|:c3496800-3496225 Pseudomonas putida KT2440 chromosome, complete genome
ATGATTCGCAGCGAATTGCTCGCACTGGAGAACACGATGGCGAAGAAGGAAAGCACTCAGCACAAACTCG
ACCGCGTTCGCGCGCCTCGGGTCCATATCACCTACGACGTGGACATCGGCGATGCCATCGAGAAAAAGGA
GCTGCCCTTCGTCGTCGGCGTACTGGGTGACTTCTCCGGCAACCCGCCGGAGCCGCTGCCCAAGCTCAAG
GACCGCAAGTTCGTGTACATCGATCGCGACAACTTCAACGGTGTGCTCAAGGGCATCAAGCCACGCCTGA
CCTACCGCGTCGACAACACCCTGGCCAAGAACGGTACCCAGTTGGGCGTGGAGCTGAACTTCAACAGCCT
CGAAGACTTCGAGCCACAGAACGTGGTCAAGCAGGTCGAGCCGCTGCGCAAGCTGCTGGAAGTGCGCAAC
AAGCTGGCCGACCTGCGCAACAAGATGGGCGGCAACGACAAGCTCGAAGAGCTGCTGATGGACGTGCTGC
AGAACACCGAAAAGCTCAAGACCTTGGGCAAGGAATTCGGCCGTGAAGCCGAAGTGAAAGACCCGTCCAG
CGACGATCGCGCCTGA
 Primer design