SecReT6
Protein ID: 26989825
SecReT6 ID14
T6SS typei4b
Gene symbol-
Locus tagPP_3106
StrainPseudomonas putida KT2440
Repliconchromosome [GenBank: NC_002947] [Browse all T6SS(s) in this replicon]
Location [Strand]3508370..3510226 [+]
Producthypothetical protein
NoteTssI
UniProt IDQ88I93
KEGG IDppu:PP_3106
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.70E-81, Aligned region: 38..347
Phage_base_V [PF04717], Evalue: 3.70E-24, Aligned region: 381..474
Gp5_C [PF06715], Evalue: 5.90E-06, Aligned region: 525..547
Gp5_C [PF06715], Evalue: 5.90E-06, Aligned region: 553..565
DUF2345 [PF10106], Evalue: 0.00043, Aligned region: 564..612
Protein Sequence: 618 a.a.     [Download]
>gi|26989825|ref|NP_745250.1| unnamed protein product [Pseudomonas putida KT2440]
MLTDVLSMLAPQNRRLFKLNILTQTANDEFLLEHFSGTEELSKLYEFDLALLSQQSDVKLKSLIGSQATV
EIELSNGSFRHINGYVQRFSTQGSDGGYVRYAAVLGPWLWMLTCRFDTRIFQEKSVQAVVSEVFAGFGTL
AKYEFRVSKPLKSHSYITQYRESDFNFVQRLLESEGLFYYFEHTADSHLMVITDDSSTLLPLPEQPQIRY
HSASVTETADSITQWQSTRQLQSGQIAVRTFDYRQPRNFLPVTMQSLNQQGDVDRFEIYDFPGQYTHGSY
EDGEAIVRNRIEALELMGKTFYGESNCRAMKPGYTFELTQHYLHDTGAAENRKFLLLSVEHRGSNNYMTG
DQAGYVNRFVCVRKKIAYRPQLNTRKPLINGPQTAIVVGPPGEEIFTDELGRVKLQFHWDRQGQFNDQSS
CWVRVAQSGASGGFGSIQIPRVGDEVVVVFLDGNPDRPLIMGSLYNSTNTPPWSLPANKTQSGFLTRSMK
GDGGTANFFRFEDKAGAEQIIMHAERNMDTEIELDETHDVGNNRSITVGGTHTETVKKDTVVQVTEGSYT
LQVDNQFIQVAAKQHIILQVGDSSITLTPEGIEIKGKVIVTTSTDTTQITGAAVRIND
 
Nucleotide Sequence: 1857 bp     [Download]
>gi|26986745|ref|NC_002947.3|:3508370-3510226 Pseudomonas putida KT2440 chromosome, complete genome
ATGCTAACTGACGTTCTTTCCATGCTCGCGCCGCAAAACAGGCGATTGTTCAAGCTGAATATCCTGACAC
AAACAGCCAACGATGAGTTTTTGCTGGAGCACTTTTCCGGCACTGAAGAGCTTTCCAAACTCTATGAATT
CGATCTGGCCTTGCTCAGCCAACAGAGCGATGTAAAGCTCAAGTCACTGATTGGCAGCCAGGCCACGGTA
GAAATAGAGTTATCCAACGGCTCTTTCCGCCACATTAACGGCTATGTTCAGCGGTTTAGCACCCAAGGCA
GCGACGGCGGCTATGTGCGTTATGCAGCCGTGCTAGGGCCGTGGCTGTGGATGCTGACTTGCCGTTTCGA
TACACGCATTTTTCAAGAAAAATCGGTCCAGGCTGTTGTCAGTGAAGTGTTCGCCGGATTTGGCACGCTG
GCCAAGTACGAATTTCGTGTAAGCAAGCCGCTCAAATCGCACAGCTACATTACCCAGTACCGCGAGAGCG
ATTTCAACTTTGTGCAGCGCTTGCTTGAGAGCGAAGGGCTTTTCTACTACTTCGAGCACACGGCCGACTC
CCACCTGATGGTCATCACCGATGACTCCAGCACCTTGTTGCCGCTGCCCGAACAGCCGCAGATTCGCTAC
CACTCCGCGTCGGTTACCGAAACCGCTGATTCCATTACTCAGTGGCAGTCAACGCGGCAGCTGCAATCCG
GTCAAATTGCCGTTCGCACGTTCGACTATCGCCAACCGCGCAACTTCCTACCTGTGACCATGCAAAGCTT
GAATCAACAGGGCGATGTGGACAGGTTCGAGATTTATGATTTCCCGGGCCAGTACACCCATGGCAGCTAC
GAAGATGGCGAAGCCATCGTACGCAACCGTATCGAAGCGCTCGAGTTGATGGGCAAGACCTTCTACGGCG
AGAGCAATTGCCGGGCCATGAAGCCGGGTTACACTTTTGAGTTGACCCAGCATTATCTGCACGACACCGG
TGCCGCCGAGAACCGTAAGTTTTTGTTGCTGAGCGTGGAGCATCGCGGCAGCAACAACTACATGACGGGC
GACCAGGCCGGTTACGTCAACCGATTCGTGTGCGTGCGTAAAAAAATCGCATACCGCCCGCAGTTGAACA
CCCGCAAGCCTTTGATCAACGGCCCGCAGACCGCCATCGTTGTCGGCCCCCCAGGCGAGGAAATCTTCAC
CGACGAACTGGGCCGGGTAAAGCTTCAGTTTCACTGGGATCGCCAGGGGCAGTTCAACGATCAAAGCTCC
TGCTGGGTACGTGTCGCCCAGTCCGGTGCCAGCGGTGGCTTCGGCAGCATCCAGATTCCGCGCGTAGGCG
ACGAAGTGGTGGTGGTGTTCCTGGACGGCAACCCGGACCGGCCGCTGATCATGGGCAGCCTGTACAACAG
CACCAACACCCCGCCATGGTCGCTGCCGGCGAACAAGACCCAGAGTGGGTTCCTGACGCGGTCGATGAAG
GGCGACGGCGGTACCGCCAACTTCTTCCGCTTCGAGGACAAGGCCGGCGCCGAGCAGATCATCATGCATG
CCGAGCGCAACATGGATACCGAGATCGAGCTGGATGAGACCCACGATGTGGGGAATAACCGCTCGATTAC
TGTTGGTGGTACGCATACCGAAACGGTCAAGAAAGACACCGTGGTGCAGGTGACCGAGGGTTCCTACACC
CTGCAGGTCGACAACCAGTTCATCCAGGTGGCCGCCAAGCAGCACATCATCCTGCAGGTGGGCGACAGCA
GCATCACGCTGACCCCGGAAGGCATCGAGATCAAAGGCAAGGTCATCGTGACCACCAGTACCGACACCAC
CCAGATCACTGGCGCCGCAGTGCGGATCAACGACTGA
 Primer design