SecReT6
Protein ID: 26990772
SecReT6 ID15
T6SS typei1
Gene symbol-
Locus tagPP_4071
StrainPseudomonas putida KT2440
Repliconchromosome [GenBank: NC_002947] [Browse all T6SS(s) in this replicon]
Location [Strand]4596179..4599805 [-]
Producthypothetical protein
NoteTssM
UniProt IDQ88FL8
KEGG IDppu:PP_4071
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.50E-88, Aligned region: 526..833
ImcF-related_N [PF14331], Evalue: 6.80E-69, Aligned region: 219..479
ImcF-related_N [PF14331], Evalue: 6.80E-69, Aligned region: 732..754
DUF1215 [PF06744], Evalue: 6.70E-31, Aligned region: 930..1051
Protein Sequence: 1208 a.a.     [Download]
>gi|26990772|ref|NP_746197.1| unnamed protein product [Pseudomonas putida KT2440]
MNQLWKYLKRWGWPLMTRIGLAMPLLLGLGAVLMLVAIWWLGPQWTWRDQQPLASVAHRSMASLVFVLVA
LLSWLVVLRTRFRRLQAERQQAMAAEVDPTQPFVHAQEKALSQGLARYLDNAGGRRALYRLPWYLVLGAR
QAGKSSFIDCTDQSFSLTRIDKAQARGRPAQALAYPVGWWISNDAVIIDPPGAFISQNGPADSLGSDSTD
VESSVPSGTQAKLWQHLLDWLQRNRSQRALNGLVLVVDLPALLHGTVEQRTALAHLLRTRLYEVSSQLGS
RLPLYVVLSKFDLLDGFDQFYSKLSAAKRNSLFGFTFKLDAVDTFDAWLGEYGEHYDRLLEQLFEQVIDR
LDVQGSPALRSRLYSLHRQLLGLRPMLLSFLRETLASDRFTTPALVRGVYWSSVVQHGDVRNAFVREAAQ
PYKTSLPLLEGKPQAKALAYFIQQAFGRVIYKEAGLAGDNVRVARRKRQLLWVGSSVGVLAFCVAIASWH
RYFDINGVKAASVLAKSREYSHHEVDQRLDPTGRNLLEPLDQIRDAVAVFGDYRAAWPGVADLGLYQGRT
IGPTVDEAYLSLLSRRFLPALASGVIEAMDAAPPGSEQQMAALRVYRMLEDRRNRRAEWVEDWMARQWQQ
AFPGQGQLQRDLMRHLKYALTYADTDLPQYRQRVSHVQQTLRKVPLPQRVYAGLKQQAQEQLHTGLDLRH
QVGPAFDVVYQLSSGSSQGDNGVLLAPMLTAKGFKEYFEPRSQRFTEMAMIDQWALGERAQLDYSDADQA
ALNERLRNLYSADYIDSWRRALNAFSVADFRDLDHGVTILEQLAGPAAPLHRLLETVRDNSSLLSPVNVG
VADEAPSPVSINSKPEQQQALVIQRAFAGLSAMLHAAGEKPSYYDETHAAIVAVHDYAKAVQGSPDRGKA
ALHAVHQRFSMTGHDPIGTLQRVATGLPEPINHHVRKVAHQTAQVLNVEALRELERRWDAEVYSFFQQRL
AERYPFVVRAPDASLEDFEAFFGPNGRLQQFQDQYLKLFLKDNLEALQNGLQGRSLIRTDVIEQLERADR
IRETFFDQRGNLSVQFSIEPLGLSANQRTSLLDLDGQLISYTHGPSQITGIVWPNTLGQHVRSNLTLLRQ
NGNSSSLEYRGPWSMFRLLSRGALNGRTATSVDLSFKTGDGVMRYRLNAEKAFNPITQQPFKGFRLPRGL
LQQPVRVALAEQADVPVM
 
Nucleotide Sequence: 3627 bp     [Download]
>gi|26986745|ref|NC_002947.3|:c4599805-4596179 Pseudomonas putida KT2440 chromosome, complete genome
ATGAATCAACTCTGGAAGTACCTCAAACGTTGGGGCTGGCCGCTGATGACCCGTATCGGTCTGGCAATGC
CGCTGCTACTTGGGCTTGGCGCTGTGCTGATGCTGGTCGCCATCTGGTGGCTCGGCCCGCAATGGACGTG
GCGCGATCAGCAGCCGTTGGCCAGTGTGGCGCATCGTAGTATGGCCAGCCTGGTGTTCGTGTTGGTGGCG
CTGTTGAGCTGGCTGGTTGTCTTGAGAACGCGCTTTCGTCGCTTGCAAGCAGAACGTCAGCAGGCGATGG
CTGCCGAGGTGGATCCGACGCAACCGTTCGTTCATGCACAAGAGAAGGCGTTGAGCCAAGGGCTCGCACG
CTACCTGGACAATGCCGGTGGGCGTCGCGCGCTGTACCGATTGCCGTGGTACCTCGTGCTGGGCGCCAGG
CAGGCCGGCAAGAGCAGCTTTATTGACTGCACCGATCAAAGTTTCTCGTTGACCCGCATCGACAAGGCGC
AGGCACGGGGCCGGCCAGCGCAGGCGCTCGCCTACCCCGTGGGGTGGTGGATCAGCAATGATGCGGTGAT
CATCGACCCGCCCGGTGCCTTTATCAGCCAGAACGGCCCCGCAGATTCGCTGGGCAGTGACTCCACTGAC
GTTGAGTCTTCGGTACCGTCTGGAACCCAAGCCAAACTGTGGCAGCATCTGTTGGATTGGCTGCAGCGCA
ATCGAAGCCAGAGAGCCCTCAACGGCCTGGTGCTGGTTGTCGACCTGCCTGCGCTACTGCACGGTACCGT
CGAGCAACGCACGGCCCTTGCCCACCTGCTGCGCACACGTCTTTACGAGGTGAGCAGCCAGTTGGGCTCG
CGCTTGCCGCTGTATGTCGTGTTGAGCAAGTTCGATCTGCTGGACGGCTTCGACCAATTCTACAGCAAGC
TTTCGGCCGCCAAGCGCAATAGCCTGTTTGGATTCACGTTCAAGCTGGATGCTGTCGACACCTTCGACGC
TTGGCTGGGCGAGTATGGCGAACACTACGATCGGTTGCTGGAGCAGCTGTTCGAGCAGGTGATCGATCGT
CTGGACGTGCAGGGTAGCCCTGCGTTGCGTTCACGTCTCTACTCACTGCATAGGCAGTTGCTCGGGTTGC
GTCCAATGCTGTTGAGTTTTCTGCGCGAGACCTTGGCAAGTGACCGTTTCACCACCCCGGCGCTGGTGCG
CGGTGTGTATTGGTCGTCAGTCGTACAGCACGGTGACGTGCGCAACGCCTTTGTCCGTGAGGCGGCGCAG
CCTTACAAGACCAGCCTCCCGTTGCTTGAGGGCAAGCCGCAGGCCAAGGCGTTGGCCTACTTCATTCAAC
AGGCCTTTGGGCGGGTCATCTACAAAGAGGCCGGCCTTGCCGGCGATAACGTCAGGGTGGCTCGGCGCAA
GCGCCAACTGCTGTGGGTGGGTTCTTCTGTAGGCGTTCTGGCCTTCTGCGTCGCCATCGCCAGCTGGCAT
CGTTACTTCGACATCAATGGCGTCAAGGCCGCCAGCGTGCTGGCCAAGAGCCGGGAGTACAGCCATCACG
AAGTGGATCAGCGTCTGGACCCGACCGGGCGCAACTTGCTGGAGCCGCTGGACCAGATCCGCGATGCGGT
AGCAGTGTTTGGCGACTACCGCGCTGCGTGGCCGGGTGTTGCTGATCTGGGGCTGTACCAGGGCCGTACC
ATCGGGCCGACCGTGGATGAGGCGTACCTCAGCTTGTTGTCCAGGCGCTTCTTGCCTGCGTTGGCCAGCG
GCGTGATCGAGGCCATGGATGCGGCGCCCCCCGGCAGCGAGCAGCAAATGGCCGCGCTCCGGGTTTACCG
GATGCTTGAGGATCGCCGGAACCGTCGAGCGGAATGGGTCGAGGACTGGATGGCGCGACAGTGGCAACAG
GCGTTCCCCGGCCAGGGGCAGCTGCAACGAGACCTCATGCGGCACCTGAAGTATGCGCTGACCTACGCGG
ATACCGACCTGCCGCAGTATCGCCAGCGTGTCAGCCACGTGCAGCAGACATTGCGTAAGGTGCCGTTGCC
ACAACGCGTGTATGCGGGCCTGAAGCAGCAGGCCCAGGAGCAGTTGCATACCGGTCTGGACCTGCGTCAT
CAGGTGGGGCCTGCGTTCGATGTCGTTTACCAGCTGTCTTCCGGCTCGAGCCAGGGCGACAATGGTGTTT
TGCTGGCGCCAATGCTCACTGCCAAAGGCTTCAAGGAGTACTTTGAACCGCGTAGTCAGCGCTTTACGGA
AATGGCCATGATCGACCAGTGGGCACTGGGGGAACGTGCTCAACTGGATTACTCCGATGCCGACCAGGCT
GCGCTGAACGAGCGCCTGCGCAACCTGTACAGCGCCGACTACATCGACAGCTGGCGCCGCGCCTTGAACG
CATTCTCCGTGGCGGATTTTCGAGACCTGGATCATGGCGTCACGATCCTTGAACAGTTGGCCGGGCCAGC
GGCGCCGTTGCACCGATTGCTGGAGACGGTTCGCGACAACAGTTCGCTGTTATCACCGGTTAATGTTGGC
GTGGCGGATGAGGCCCCTTCGCCCGTTTCGATCAACAGCAAGCCTGAGCAACAACAGGCGCTGGTCATTC
AGCGGGCGTTTGCAGGCTTGAGCGCCATGTTGCACGCTGCAGGCGAAAAACCGAGCTACTACGATGAAAC
CCACGCAGCCATAGTCGCCGTCCACGACTATGCCAAGGCGGTACAGGGTAGCCCAGACCGAGGCAAGGCT
GCGCTGCACGCAGTGCATCAACGCTTTTCAATGACCGGGCACGACCCCATCGGCACCTTGCAACGCGTTG
CCACTGGCTTGCCGGAGCCAATCAATCACCACGTTAGAAAGGTGGCACATCAAACGGCACAGGTGCTGAA
CGTTGAAGCGCTGCGCGAGTTGGAGCGGCGATGGGATGCTGAAGTCTACAGCTTCTTCCAGCAGCGCCTG
GCAGAGCGCTACCCTTTCGTAGTCAGGGCACCCGACGCTTCGCTGGAAGACTTTGAAGCGTTCTTCGGGC
CGAATGGGCGACTGCAGCAGTTCCAGGATCAATATCTGAAGCTTTTCCTCAAGGACAATCTGGAAGCCTT
GCAGAATGGTTTGCAGGGGCGATCCCTGATCCGTACCGATGTGATCGAGCAGCTGGAACGGGCCGATCGC
ATCCGCGAAACGTTCTTTGATCAGCGCGGTAACCTCAGCGTGCAGTTCAGTATCGAGCCGTTGGGGCTTA
GTGCAAATCAACGCACCAGCCTGCTGGATCTGGATGGCCAGCTGATTTCCTACACCCACGGCCCAAGCCA
GATCACCGGTATTGTCTGGCCCAATACCTTGGGGCAACACGTGCGCAGCAACCTGACCCTGCTCAGGCAG
AACGGCAATAGCAGCAGCCTGGAGTATCGAGGGCCTTGGTCGATGTTTCGCCTGCTGAGCCGCGGTGCGC
TCAATGGGCGTACGGCAACCAGCGTGGACCTGAGCTTCAAAACAGGTGATGGTGTGATGCGCTACCGGCT
GAACGCGGAAAAGGCCTTCAATCCTATTACTCAACAACCGTTCAAAGGTTTTCGGTTGCCCCGAGGGTTG
TTGCAACAGCCAGTCAGGGTGGCGTTGGCCGAACAGGCGGATGTGCCTGTCATGTAG
 Primer design