SecReT6
Protein ID: 26990775
SecReT6 ID15
T6SS typei1
Gene symbol-
Locus tagPP_4074
StrainPseudomonas putida KT2440
Repliconchromosome [GenBank: NC_002947] [Browse all T6SS(s) in this replicon]
Location [Strand]4602163..4602666 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ88FL5
KEGG IDppu:PP_4074
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.70E-54, Aligned region: 7..158
Protein Sequence: 167 a.a.     [Download]
>gi|26990775|ref|NP_746200.1| unnamed protein product [Pseudomonas putida KT2440]
MTKRSDSVAPKERINIKYVPATGDEQAEVELPHKMMVLGDFGLDDSRSLEDRQVMRIDKHTFNNVLNDAD
VSLAMSVPSALDATPNAELAVNLQFKSIQDFGPDRIARQVPELNKLLQLREALVALKGPLGNVPTFRKQL
QQLLNDAHARKQLAQELDLVLEAPKAD
 
Nucleotide Sequence: 504 bp     [Download]
>gi|26986745|ref|NC_002947.3|:4602163-4602666 Pseudomonas putida KT2440 chromosome, complete genome
ATGACTAAACGCTCCGATTCCGTTGCACCCAAAGAACGCATCAACATCAAATATGTGCCCGCCACCGGTG
ACGAGCAGGCCGAGGTAGAGCTGCCGCACAAGATGATGGTGCTGGGCGACTTCGGCCTCGATGACAGCCG
CTCCCTCGAAGACCGCCAGGTCATGCGCATCGATAAACACACCTTCAACAACGTGTTGAATGACGCCGAT
GTGAGCCTGGCCATGTCGGTGCCCTCCGCGCTTGACGCAACTCCGAATGCAGAGCTGGCAGTCAACCTGC
AATTCAAGTCCATCCAGGACTTCGGCCCAGATCGCATCGCACGCCAGGTGCCCGAGCTGAACAAGCTGCT
GCAGTTGCGTGAAGCGCTGGTTGCCCTGAAAGGCCCGCTGGGCAACGTGCCCACCTTCCGCAAACAGCTG
CAGCAGCTTCTGAACGACGCGCATGCCCGCAAGCAACTCGCGCAAGAACTCGACCTGGTGCTTGAAGCGC
CAAAAGCAGACTGA
 Primer design