SecReT6
Protein ID: 26990776
SecReT6 ID15
T6SS typei1
Gene symbol-
Locus tagPP_4076
StrainPseudomonas putida KT2440
Repliconchromosome [GenBank: NC_002947] [Browse all T6SS(s) in this replicon]
Location [Strand]4604168..4604578 [+]
Producthypothetical protein
NoteTssE
UniProt IDQ88FL4
KEGG IDppu:PP_4076
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.50E-19, Aligned region: 25..119
Protein Sequence: 136 a.a.     [Download]
>gi|26990776|ref|NP_746201.1| unnamed protein product [Pseudomonas putida KT2440]
MSGFFDRLMADPSAIREASRQESASHKFAAIKCHLETLLNARQGCSQSSPELGLRDFNGHDVSSGDLLQQ
VSADIRRTLQRFEPRIHVRALKAVPDCHAPLELHFRLDCQVQVNNQAEQLQLELLVNGHNRYTRVR
 
Nucleotide Sequence: 411 bp     [Download]
>gi|26986745|ref|NC_002947.3|:4604168-4604578 Pseudomonas putida KT2440 chromosome, complete genome
ATGAGTGGTTTCTTCGATCGCTTGATGGCGGACCCGTCCGCCATCCGGGAGGCGTCTCGCCAGGAAAGCG
CTTCGCACAAGTTCGCGGCCATCAAGTGCCACCTCGAAACGTTGCTGAACGCTCGCCAAGGTTGCTCCCA
GAGCAGCCCCGAGCTGGGCCTGCGCGACTTCAACGGGCATGACGTCAGCAGCGGCGACCTGCTGCAGCAA
GTGAGCGCCGATATCCGCCGTACCCTCCAGCGCTTTGAACCGCGCATCCACGTGCGCGCGCTCAAAGCGG
TACCGGATTGTCACGCCCCGTTGGAACTGCATTTCAGGCTCGACTGCCAGGTGCAGGTCAACAACCAGGC
AGAGCAGTTGCAGCTTGAGCTGCTGGTAAACGGACACAACCGCTACACCCGAGTGAGGTGA
 Primer design