SecReT6
Protein ID: 26990777
SecReT6 ID15
T6SS typei1
Gene symbol-
Locus tagPP_4077
StrainPseudomonas putida KT2440
Repliconchromosome [GenBank: NC_002947] [Browse all T6SS(s) in this replicon]
Location [Strand]4604582..4606348 [+]
Producthypothetical protein
NoteTssF
UniProt IDQ88FL3
KEGG IDppu:PP_4077
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 5.70E-193, Aligned region: 4..588
Protein Sequence: 588 a.a.     [Download]
>gi|26990777|ref|NP_746202.1| unnamed protein product [Pseudomonas putida KT2440]
MSLKDRFSEELRYLHELGNDFAKDNPQLARLLGKAGSDPDVERLMEAFAFLTAKLRLKLEDDLPELTHPM
LQILWPNYLRPLPSATIIRFSPRKQSLSQSQHIPKGARLFSKPVDAVPCEFRTCTGVSLHPFEISAVSAT
QTLDSSVVRIGLQTLVERPLNTLGCARLDFHLSGDNRTALTLYLWISQYLKHVSVIMNGEVRRLPANSIG
FPGFSPEEALLPYPQNVFDGYRILQEYFVFPKRFHFFSITGLEKLWPAQACPQVGIEFHFTRQLPDTLRV
GTEDFSLFCTPAVNLFKHSAEPIDLASEAAQVELKPRSEAQSAYEIFSVDEVISTRTTTDGSTGEHLRTF
RPFESFAHEIEHVQGRTALYYRCQLEASLRGDGVTHRIAFVRADANSYIGELETASIDLTCTNRDLPLAL
GVDDINVLTEVTPPLATYTNICAPTRPYRPVLDGQLQWALISNMSLNYLSLLSVEPLKAVIRTYDFAALH
DIQQARTTGKRLDGIRELHTQPMDWLIKGQPIRGLHTQLKLDQAAFLCEGDLYLFGCVLAHFFALYASIN
SFHQLEVINTTNNEHYTWPIQTGKQPLI
 
Nucleotide Sequence: 1767 bp     [Download]
>gi|26986745|ref|NC_002947.3|:4604582-4606348 Pseudomonas putida KT2440 chromosome, complete genome
ATGTCACTGAAGGACAGATTCAGCGAAGAACTGCGTTACCTGCACGAGTTGGGAAACGACTTCGCCAAGG
ACAACCCCCAGCTTGCCCGGCTGCTAGGCAAGGCGGGCAGCGACCCCGATGTCGAGCGGTTGATGGAAGC
CTTTGCGTTTCTAACGGCCAAGCTTCGGCTGAAGCTGGAAGATGACCTGCCAGAACTCACCCACCCCATG
CTGCAGATACTGTGGCCCAACTACCTGCGCCCATTGCCCAGCGCCACGATTATCCGATTCTCGCCACGCA
AACAATCGCTCAGCCAGTCACAGCACATTCCCAAAGGTGCAAGGTTGTTCTCGAAACCCGTGGACGCCGT
GCCCTGCGAGTTTCGTACCTGCACGGGAGTGAGCCTTCATCCGTTTGAAATCAGCGCCGTCAGCGCAACC
CAGACACTCGACAGCTCTGTGGTTCGCATCGGCCTGCAAACCTTGGTCGAACGGCCCCTGAATACGTTGG
GCTGCGCCCGTCTGGATTTCCACCTCAGCGGCGACAACCGCACCGCTCTGACGCTTTATCTATGGATTTC
TCAATACCTCAAACACGTCAGCGTGATCATGAACGGCGAGGTGCGCCGGCTACCGGCCAACAGCATCGGG
TTCCCAGGTTTCAGCCCTGAGGAGGCCTTGCTGCCCTACCCGCAGAACGTGTTCGATGGCTACCGTATTC
TGCAGGAATACTTCGTGTTCCCGAAGCGCTTCCACTTCTTCAGCATTACCGGCCTGGAAAAGCTGTGGCC
GGCACAAGCCTGCCCACAGGTGGGCATCGAGTTCCATTTCACGCGTCAACTGCCAGACACCCTTCGCGTT
GGCACAGAAGATTTCAGCCTGTTCTGCACCCCGGCTGTCAACCTGTTCAAGCACAGTGCCGAGCCCATCG
ACCTGGCCAGCGAGGCTGCCCAGGTCGAGCTGAAGCCCAGAAGCGAGGCGCAGTCCGCTTACGAAATCTT
CAGTGTCGATGAAGTCATCAGCACCCGAACAACCACTGACGGAAGTACCGGTGAGCACCTGCGGACTTTT
CGCCCTTTCGAATCGTTCGCCCACGAAATCGAGCATGTCCAAGGCCGCACGGCGCTGTACTACCGCTGCC
AACTTGAAGCGTCCCTGCGCGGCGATGGCGTGACCCACCGCATCGCCTTCGTGCGCGCCGATGCCAACAG
CTACATAGGCGAGCTTGAAACTGCATCCATCGACCTGACCTGCACCAACAGGGACTTGCCGCTGGCGCTG
GGCGTGGATGACATCAACGTCCTCACCGAAGTCACGCCGCCCCTGGCGACCTATACCAACATCTGCGCCC
CCACCCGCCCCTACCGGCCCGTGCTGGATGGCCAGTTGCAGTGGGCGTTGATCTCCAACATGTCGCTCAA
CTACCTGTCGCTGTTGTCGGTCGAGCCGCTCAAGGCGGTGATTCGCACCTACGACTTCGCGGCGTTGCAC
GACATCCAGCAAGCGCGCACCACCGGCAAACGCCTCGACGGTATCCGCGAACTCCACACGCAGCCCATGG
ACTGGCTGATCAAGGGGCAACCCATACGAGGCCTGCACACCCAACTGAAGCTGGACCAGGCGGCCTTCCT
CTGCGAAGGCGACCTCTACCTGTTCGGCTGCGTGCTCGCGCACTTCTTCGCCCTGTACGCCAGCATCAAT
TCCTTCCATCAACTGGAAGTGATCAACACCACCAACAACGAGCACTACACATGGCCCATCCAGACCGGCA
AGCAACCGCTGATCTAG
 Primer design