SecReT6
Protein ID: 26990778
SecReT6 ID15
T6SS typei1
Gene symbol-
Locus tagPP_4078
StrainPseudomonas putida KT2440
Repliconchromosome [GenBank: NC_002947] [Browse all T6SS(s) in this replicon]
Location [Strand]4606312..4607328 [+]
Producthypothetical protein
NoteTssG
UniProt IDQ88FL2
KEGG IDppu:PP_4078
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.10E-86, Aligned region: 18..321
Protein Sequence: 338 a.a.     [Download]
>gi|26990778|ref|NP_746203.1| unnamed protein product [Pseudomonas putida KT2440]
MAHPDRQATADLADKLLANAHQYNFFQLLERLHGLHGDDLEPRWADEATRLRVRLASDPRLTFPVSDVYK
AERMPGEDERYRVCTTFMGLHGTDSPLPTYYLEQVAYEHAQGVGVRPAFFDFFNHYLLSLLHRIWRKYRY
YIRFQPGARDGFSQYMFALLGLNDKQLRGDTTLPWSRLLSFAGVIASRGRAPGTVAGIIAHCFDLTHVQI
REFETRTVTTNSKQLVSLGRSNGELGSTFMVGSRTRTRSSKFTILISELDQAQLHDLLPSGINFGRLRAL
IDFLLRDGLAYDLELRLKQNALSPFYLHRSQGAYLGWTSFVDDHDGQISPVVRFRGRS
 
Nucleotide Sequence: 1017 bp     [Download]
>gi|26986745|ref|NC_002947.3|:4606312-4607328 Pseudomonas putida KT2440 chromosome, complete genome
ATGGCCCATCCAGACCGGCAAGCAACCGCTGATCTAGCCGACAAGCTGCTCGCCAACGCGCACCAGTACA
ACTTCTTCCAGTTGCTGGAGCGGTTGCATGGCCTGCACGGCGACGACCTGGAACCGCGTTGGGCGGATGA
GGCCACCCGGCTGCGCGTGCGGCTGGCCAGCGACCCGCGCCTGACCTTTCCCGTCTCTGATGTGTACAAG
GCCGAGCGGATGCCCGGGGAGGATGAGCGCTATCGCGTGTGCACCACGTTCATGGGGCTGCACGGTACCG
ACTCGCCCTTGCCCACCTATTACCTGGAACAGGTGGCCTATGAACATGCCCAGGGTGTAGGCGTGCGGCC
GGCCTTCTTCGACTTCTTCAACCATTACCTGCTCAGCCTGCTGCACCGGATCTGGCGCAAGTACCGCTAT
TACATCCGTTTTCAACCCGGTGCGCGGGACGGGTTCTCCCAGTACATGTTCGCCCTGCTCGGGCTGAACG
ACAAACAGCTGCGCGGCGACACGACACTGCCCTGGAGCCGCCTGCTCAGCTTTGCCGGTGTTATCGCCAG
CCGCGGCCGCGCACCGGGGACCGTCGCCGGCATCATCGCCCACTGCTTCGATCTGACGCACGTGCAGATC
CGCGAATTCGAGACGCGCACGGTCACCACCAACAGCAAACAGCTTGTAAGCCTCGGGCGCAGCAACGGCG
AGCTTGGCAGCACGTTCATGGTCGGCAGCCGCACCCGCACCCGCAGCAGCAAATTCACCATCCTCATCAG
CGAACTCGACCAGGCGCAGCTGCATGACTTGCTGCCCAGCGGCATCAACTTCGGACGCTTGCGCGCCTTG
ATTGATTTTCTGCTGCGCGATGGCCTGGCGTATGACCTGGAGCTGCGCCTGAAACAAAACGCACTGTCGC
CGTTCTACCTGCACCGCAGCCAAGGCGCCTACCTGGGCTGGACCAGCTTCGTCGATGACCACGATGGCCA
AATCAGTCCCGTTGTCCGCTTCCGGGGGCGGTCATGA
 Primer design