SecReT6
Protein ID: 26990779
SecReT6 ID15
T6SS typei1
Gene symbol-
Locus tagPP_4079
StrainPseudomonas putida KT2440
Repliconchromosome [GenBank: NC_002947] [Browse all T6SS(s) in this replicon]
Location [Strand]4607325..4608122 [+]
Producthypothetical protein
NoteTssJ
UniProt IDQ88FL1
KEGG IDppu:PP_4079
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.40E-23, Aligned region: 17..65
T6SS-SciN [PF12790], Evalue: 1.40E-23, Aligned region: 156..256
Protein Sequence: 265 a.a.     [Download]
>gi|26990779|ref|NP_746204.1| unnamed protein product [Pseudomonas putida KT2440]
MSRLAVWIAPLLVVLVGLPGCTSLSRATKVALDHSLPIGPPKDNPTQVAFSINVSPTLNSNPNSVDVAAI
PESILEPSPYAVTLSAGDPHALTDKVGTLLEYLQAQFPAMSRVETGEEDQSEWVRSPMEESSPGSYDDPT
VVLTLPSSKAEASGPVATPIAIKILQLRDDSLLRNSVYQLLDDDPAKALRSTYIRDDDYLLNPGQFKFIP
FEPIEPETRFVAVIGDYRNQENATWQQVLRIPPRGHQIILSVLVNDAQILLKEEE
 
Nucleotide Sequence: 798 bp     [Download]
>gi|26986745|ref|NC_002947.3|:4607325-4608122 Pseudomonas putida KT2440 chromosome, complete genome
ATGAGCCGCCTGGCCGTCTGGATTGCGCCTCTGCTGGTCGTGCTGGTCGGACTGCCAGGTTGCACGTCCT
TGAGCAGAGCCACCAAGGTGGCGCTGGACCACTCGTTACCAATCGGGCCGCCCAAGGACAACCCAACCCA
AGTCGCGTTCAGCATCAACGTCAGCCCAACGCTCAACAGCAACCCGAACAGTGTCGACGTGGCGGCCATC
CCTGAGAGCATCCTGGAACCCAGCCCCTACGCAGTCACCTTGAGCGCCGGCGATCCGCACGCACTGACCG
ACAAAGTCGGGACCTTGCTTGAGTACCTGCAAGCGCAATTCCCCGCGATGTCCCGCGTGGAAACCGGCGA
AGAGGACCAAAGCGAATGGGTTCGCTCCCCGATGGAAGAAAGCTCGCCCGGCAGCTATGACGACCCCACG
GTGGTGCTCACGCTGCCGAGCAGCAAGGCCGAAGCCAGCGGGCCTGTCGCCACACCGATTGCCATCAAGA
TCCTGCAACTGCGCGATGACTCGCTGCTGCGCAACAGCGTGTACCAACTGCTGGACGATGACCCCGCCAA
GGCACTGCGCAGTACCTACATCCGCGATGACGATTACCTGCTGAACCCAGGCCAGTTCAAGTTCATACCG
TTTGAGCCCATCGAGCCCGAGACCCGCTTCGTCGCGGTGATCGGCGACTACAGAAACCAGGAGAACGCGA
CCTGGCAGCAAGTGTTGCGGATTCCGCCACGCGGCCACCAGATCATTCTCTCAGTGCTGGTCAATGACGC
GCAGATCCTGCTCAAGGAGGAGGAATGA
 Primer design