SecReT6
Protein ID: 26990780
SecReT6 ID15
T6SS typei1
Gene symbol-
Locus tagPP_4080
StrainPseudomonas putida KT2440
Repliconchromosome [GenBank: NC_002947] [Browse all T6SS(s) in this replicon]
Location [Strand]4608172..4609509 [+]
Producthypothetical protein
NoteTssK
UniProt IDQ88FL0
KEGG IDppu:PP_4080
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.40E-150, Aligned region: 19..443
Protein Sequence: 445 a.a.     [Download]
>gi|26990780|ref|NP_746205.1| unnamed protein product [Pseudomonas putida KT2440]
MSSRNPVLWPEGLFVKPQHFQQAARASEAALHQRLGSLNAAFYGFSELQLSTEYLSLGKVAITKARGIMP
DGTVFDIPADLPPPPPLEIEDDGSKDSEIFLCLPLRTEGGREVSWPDNAANFRYNAQAEEIKDTHSADGD
LVQVDLAVPNLQLKRKADDSSAYTRLAVARILERRPDGSLQLDETFYPTSVSVRAVPALQRFLEEITNTL
RERARNLAARIGASGQSGIADIRDFNLLQAMNRWWPCFNHLARQGQTHPEQLYLSMSQACGEFVTFTDEN
RLPQEYPAYHHTALRTSFKPLEDTLRRALSTVLQPRAVSLPLETLDFGVMTTTLEDRRLIDEADFIIAVR
ADLPPQTLRQMFIQKAKVTSLESLNDLVPLQLPGIPLLPLPVAPRDLPFHAGFSYFELDRRDPAWACMKT
ANGFGFHVAGEFPGLELQFWAIRGE
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|26986745|ref|NC_002947.3|:4608172-4609509 Pseudomonas putida KT2440 chromosome, complete genome
ATGAGTTCACGTAACCCCGTTCTGTGGCCCGAAGGCCTGTTCGTCAAACCACAACATTTCCAACAAGCTG
CGCGGGCCAGTGAAGCGGCCTTGCATCAACGCCTTGGCAGCCTCAACGCGGCCTTCTACGGCTTCAGCGA
ACTGCAGCTAAGCACCGAATACCTGAGCCTGGGCAAGGTCGCCATCACCAAGGCGCGCGGCATCATGCCC
GATGGCACGGTGTTCGATATTCCTGCCGATCTGCCGCCGCCGCCGCCCCTGGAAATCGAGGACGACGGTT
CGAAAGACAGCGAGATATTCCTGTGCTTGCCGCTGCGTACCGAGGGGGGCCGTGAAGTCAGCTGGCCCGA
CAATGCCGCCAACTTCCGCTACAACGCTCAGGCAGAGGAGATCAAGGATACCCACAGCGCCGACGGTGAC
CTGGTGCAGGTCGACCTGGCCGTGCCCAACCTGCAGCTCAAACGCAAAGCCGATGACAGCAGTGCCTACA
CCCGCCTGGCCGTGGCTCGTATCCTGGAGCGGCGCCCTGACGGTAGCCTGCAGTTGGATGAAACGTTCTA
CCCCACCAGCGTTTCGGTGCGGGCAGTGCCGGCCCTTCAGCGGTTTCTTGAAGAAATCACCAACACCCTG
CGCGAGCGTGCGCGCAATCTTGCCGCCCGCATTGGCGCTTCGGGCCAGTCGGGTATCGCCGACATCCGCG
ACTTCAACCTGCTGCAGGCCATGAACCGCTGGTGGCCGTGCTTCAACCACCTGGCCCGGCAAGGACAAAC
ACACCCCGAGCAGTTGTACCTGTCCATGAGCCAGGCGTGTGGCGAATTCGTCACCTTCACCGACGAGAAC
CGGCTGCCGCAGGAATACCCGGCCTACCACCACACCGCACTGCGTACCTCGTTCAAGCCCCTGGAGGATA
CGCTCCGTCGAGCCCTGAGCACGGTCCTGCAACCCCGCGCCGTGTCACTGCCGCTGGAGACCCTGGACTT
TGGTGTGATGACGACCACGCTGGAAGACCGGCGCCTGATTGACGAAGCCGATTTCATCATCGCCGTGCGC
GCCGACCTGCCGCCGCAGACGTTGCGCCAGATGTTCATCCAGAAAGCCAAGGTCACCTCACTCGAATCCT
TGAATGACCTGGTGCCTTTGCAACTGCCGGGCATCCCGCTGCTGCCCCTGCCGGTTGCACCACGCGACCT
GCCCTTCCATGCGGGCTTCAGCTACTTCGAACTGGACCGCCGTGACCCCGCCTGGGCCTGCATGAAGACG
GCCAACGGCTTCGGCTTCCACGTTGCAGGTGAGTTCCCAGGGCTTGAACTGCAGTTCTGGGCGATCAGGG
GTGAATGA
 Primer design