SecReT6
Protein ID: 26990781
SecReT6 ID15
T6SS typei1
Gene symbol-
Locus tagPP_4081
StrainPseudomonas putida KT2440
Repliconchromosome [GenBank: NC_002947] [Browse all T6SS(s) in this replicon]
Location [Strand]4609454..4610386 [+]
Producthypothetical protein
NoteTssL
UniProt IDQ88FK9
KEGG IDppu:PP_4081
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.40E-62, Aligned region: 88..293
Protein Sequence: 310 a.a.     [Download]
>gi|26990781|ref|NP_746206.1| unnamed protein product [Pseudomonas putida KT2440]
MQVSSQGLNCSSGRSGVNDMENSNPTLNDAKHVAETDLQSMLEKSLPNDAPAAAAAASTASAQEQKPEPA
YQGYPADPEFQLRGGCANLMLDAAAPLFGLVMRLRTLDELPNIKDVHQQVRIQIDSIREEIRQHGYEPAQ
LLAYSYGLCLYIDEAVMERPWGKSSCWSHEPLLSIFHDETWGGEKIFTVITRLMQEPKRYQDVLEFMYFA
LCLGLKGKYALAPKGEETLNALIHQLHGIIRELRGPTPEEVCDPYTNVAPRNFRMSRIWPWWSPLVISAI
AMAVAYGIYSYRLHLITTEVLESLNGILQQ
 
Nucleotide Sequence: 933 bp     [Download]
>gi|26986745|ref|NC_002947.3|:4609454-4610386 Pseudomonas putida KT2440 chromosome, complete genome
TTGCAGGTGAGTTCCCAGGGCTTGAACTGCAGTTCTGGGCGATCAGGGGTGAATGATATGGAAAACAGTA
ACCCTACCCTCAACGACGCGAAGCACGTTGCGGAAACGGATTTGCAGTCGATGCTTGAGAAGTCGTTGCC
CAACGACGCACCCGCAGCTGCAGCTGCAGCTTCCACTGCATCTGCACAGGAGCAGAAGCCGGAACCTGCC
TATCAGGGCTACCCCGCGGACCCGGAGTTTCAGCTCAGGGGTGGCTGCGCCAATCTCATGCTGGATGCTG
CGGCACCCTTGTTCGGGCTGGTAATGCGCCTGCGCACGCTCGATGAACTGCCCAACATCAAAGATGTGCA
TCAGCAAGTGCGTATTCAGATCGACAGCATCCGGGAAGAAATACGCCAGCACGGCTATGAGCCCGCTCAG
TTGCTGGCGTACTCCTACGGCCTGTGCCTGTACATCGATGAAGCGGTGATGGAGCGGCCCTGGGGCAAAA
GCAGTTGCTGGAGCCACGAGCCGCTGCTCAGCATCTTCCACGACGAGACCTGGGGTGGGGAAAAAATCTT
CACCGTGATTACCCGCCTGATGCAGGAGCCCAAGCGTTATCAGGACGTACTGGAGTTCATGTACTTCGCC
CTGTGCCTTGGGCTGAAGGGCAAGTATGCGCTCGCGCCGAAAGGCGAAGAAACACTCAACGCACTGATTC
ACCAACTGCACGGGATCATCCGCGAACTGCGCGGCCCCACCCCCGAAGAAGTCTGCGACCCCTACACCAA
CGTCGCCCCCAGAAACTTCCGCATGAGCCGGATATGGCCGTGGTGGAGCCCGTTGGTCATCTCCGCCATC
GCCATGGCGGTGGCCTACGGGATTTACAGCTACCGCCTGCACCTGATCACAACCGAGGTGCTGGAGTCGC
TGAACGGCATTTTGCAGCAATAG
 Primer design