SecReT6
Protein ID: 26990784
SecReT6 ID15
T6SS typei1
Gene symbol-
Locus tagPP_4085
StrainPseudomonas putida KT2440
Repliconchromosome [GenBank: NC_002947] [Browse all T6SS(s) in this replicon]
Location [Strand]4613627..4618219 [+]
ProductRHS family protein
NotePAAR
UniProt IDQ88FK6
KEGG IDppu:PP_4085
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 1.20E-56, Aligned region: 436..461
RHS_repeat [PF05593], Evalue: 1.20E-56, Aligned region: 493..530
RHS_repeat [PF05593], Evalue: 1.20E-56, Aligned region: 631..664
RHS_repeat [PF05593], Evalue: 1.20E-56, Aligned region: 678..698
RHS_repeat [PF05593], Evalue: 1.20E-56, Aligned region: 692..725
RHS_repeat [PF05593], Evalue: 1.20E-56, Aligned region: 738..770
RHS_repeat [PF05593], Evalue: 1.20E-56, Aligned region: 755..791
RHS_repeat [PF05593], Evalue: 1.20E-56, Aligned region: 798..830
RHS_repeat [PF05593], Evalue: 1.20E-56, Aligned region: 818..852
RHS_repeat [PF05593], Evalue: 1.20E-56, Aligned region: 860..890
RHS_repeat [PF05593], Evalue: 1.20E-56, Aligned region: 921..955
RHS_repeat [PF05593], Evalue: 1.20E-56, Aligned region: 965..1000
RHS_repeat [PF05593], Evalue: 1.20E-56, Aligned region: 1038..1054
RHS_repeat [PF05593], Evalue: 1.20E-56, Aligned region: 1075..1089
RHS_repeat [PF05593], Evalue: 1.20E-56, Aligned region: 1122..1141
RHS_repeat [PF05593], Evalue: 1.20E-56, Aligned region: 1143..1164
RHS_repeat [PF05593], Evalue: 1.20E-56, Aligned region: 1186..1195
RHS_repeat [PF05593], Evalue: 1.20E-56, Aligned region: 1189..1224
RHS_repeat [PF05593], Evalue: 1.20E-56, Aligned region: 1210..1242
RHS_repeat [PF05593], Evalue: 1.20E-56, Aligned region: 1310..1331
Tox-SHH [PF15652], Evalue: 2.00E-27, Aligned region: 1135..1161
Tox-SHH [PF15652], Evalue: 2.00E-27, Aligned region: 1423..1524
RHS [PF03527], Evalue: 9.70E-18, Aligned region: 441..453
RHS [PF03527], Evalue: 9.70E-18, Aligned region: 676..701
RHS [PF03527], Evalue: 9.70E-18, Aligned region: 753..760
RHS [PF03527], Evalue: 9.70E-18, Aligned region: 838..851
RHS [PF03527], Evalue: 9.70E-18, Aligned region: 964..977
RHS [PF03527], Evalue: 9.70E-18, Aligned region: 1036..1053
RHS [PF03527], Evalue: 9.70E-18, Aligned region: 1301..1341
PAAR_motif [PF05488], Evalue: 4.70E-13, Aligned region: 6..16
PAAR_motif [PF05488], Evalue: 4.70E-13, Aligned region: 97..125
PAAR_motif [PF05488], Evalue: 4.70E-13, Aligned region: 191..235
DUF4595 [PF15283], Evalue: 0.00052, Aligned region: 506..521
DUF4595 [PF15283], Evalue: 0.00052, Aligned region: 645..659
DUF4595 [PF15283], Evalue: 0.00052, Aligned region: 711..725
DUF4595 [PF15283], Evalue: 0.00052, Aligned region: 765..791
DUF4595 [PF15283], Evalue: 0.00052, Aligned region: 835..875
DUF4595 [PF15283], Evalue: 0.00052, Aligned region: 948..985
MORN_2 [PF07661], Evalue: 0.0022, Aligned region: 491..501
MORN_2 [PF07661], Evalue: 0.0022, Aligned region: 710..719
MORN_2 [PF07661], Evalue: 0.0022, Aligned region: 815..826
MORN_2 [PF07661], Evalue: 0.0022, Aligned region: 964..976
MORN_2 [PF07661], Evalue: 0.0022, Aligned region: 982..993
MORN_2 [PF07661], Evalue: 0.0022, Aligned region: 1044..1060
Protein Sequence: 1530 a.a.     [Download]
>gi|26990784|ref|NP_746209.1| unnamed protein product [Pseudomonas putida KT2440]
MAQTVHAARMGDAILHPSLAAEMISAVAEAVIYAAATAAVAAAISLAVVGTVATGGAAGVAIAAVAGVAV
GAVSTLSVGEDQTVGDAISSFCDSLGNSVDSPDPYGKIESGSTNVLINSEPAARAAGITGPPGGGAADTE
QEEPSILENVGSMAMAAVPYLVPFVGLGMAIRDIFNPPVTTPANPGSEPAEGDKISCSRHPPLPDTFIAQ
GSDKVFINGQPAARSGDKTTCDATIDVNENVSPNVRIGGGTATVRDIRNGKSKIAMFTGIIAGMLISRRF
GRIKGCTLGNPVAVATGSKLQEGPEDIDFNLPGLLAIQWARRYDSRDMRSDGLLGMGWSVPYEVELARVP
HPQGGTLWIYIDNDGNRLELGRLSAGDAFISAVDGLAFFQLEDGQTVVEDINEGLYRVFDTDPLNPKRSR
LIRLGDRNLNCLDLLYDEQGRLKALYDKYGQTVVQLHYAARHPQRVSEVSRVFLKNGGTPTVERSELLVS
YRYTDNGQLHEVLDATDQRVRRFTYTPEGYLNSHQLASGAVREYEWARFAIPETRPTPKRLDGTPYRLPP
LLEPQPDHEWRVIRHWGSDGEEYRFEYNLEAGETLVTDNLGRRDHYYWGPLYEVYKHIDPQGNCWLAEVI
AGQLIKRIDPQGGEWRYSYDDIGRLIETRDPLGRSEHIKYLRHWALPIQVTDTAGRTRQYGYDSHGNLLW
QQDPLGRETQYQYDPEGRVTQVTDALEKSKYLSWNTCGQLLSYRDCSNAQTLYHYDAHGRLRESINARGE
HTHFRYDARGYLVESERPDGRIDRYEIDVAGQLTRYIDPAQKTLQFRYDPSGRLVERTDAMGYSVKFRYD
AYGRLLQLTNENDESYRFGWDELDRLVAQKDLDGSGRLYAYNVLDEVIRLTHVPSPDEQPPLSDNAPPTR
TTAIRHDFERDAIGRLVSKRTEDGTTDYRYDAADNLLSITFTDNKGEKQQLDYTYDANGQLLSETNSAGL
LQYRYDELGNLQTLVLPDQRELNHLYYGSGHLHQINLNGRVISDFERDAVHDEVLRTQGKLVTRTRYDTS
GRLAGKAIHYRDAPAEVLPLLDKAYRYDASDNLIAEVLTQTQRRGMSNAANDENANLEQIIGRFLDLPHT
GKTYSGHNRYGYDLNEQLQTVHQSRPNWQATQVEDFKYDKAGNLFDGPKLNGLIKHNRVLVYQDKRYRYD
RFGRLCEKRIGSNWVQYFEYDAEQRLVCVEQYRSGERERVVFAYDPLGRRISKEVYQRDYPEPRRRVLFH
WQGFRLLQEVQSGLASLYVYATVESYDPLARVDGKPGSEAIHYFHTTLVGQPEQLTDSDGNTIWRSDHHG
WGKIINEWHSQQNGREQNLRNQGQYIDRETGLHFNIFRFYDPDIGRFTTTDPLGIEGGVNLYSYAPNIVN
YSDPLGLCPENVKEYDITPYRPSNSPLENHHGILDIWAAQNVPSYGGKYPKGSPTIVLSSKNHAATKAVY
REWLREKTGKPVGGKVDWSQISNREVMQLSERMFDVAGVPATSRTSYYRALNRYLHTGTF
 
Nucleotide Sequence: 4593 bp     [Download]
>gi|26986745|ref|NC_002947.3|:4613627-4618219 Pseudomonas putida KT2440 chromosome, complete genome
ATGGCGCAGACCGTTCACGCCGCCCGAATGGGCGACGCAATTCTTCATCCATCGCTTGCCGCTGAAATGA
TCAGCGCAGTTGCCGAGGCCGTTATCTATGCAGCGGCCACCGCGGCCGTCGCCGCAGCCATCAGCTTGGC
CGTGGTTGGCACCGTAGCCACTGGCGGTGCGGCTGGCGTCGCCATCGCCGCAGTCGCGGGTGTGGCAGTC
GGAGCAGTGAGCACCCTTTCCGTCGGCGAAGACCAGACTGTCGGCGACGCCATCTCCAGCTTTTGCGACA
GCCTTGGCAACAGCGTGGACTCGCCCGATCCCTACGGAAAAATCGAGAGCGGGTCAACCAATGTGCTCAT
TAACAGTGAGCCCGCTGCGCGCGCGGCCGGCATCACTGGCCCACCTGGAGGCGGCGCAGCCGATACTGAA
CAAGAGGAACCGTCCATCCTGGAGAACGTCGGTTCCATGGCCATGGCTGCGGTGCCTTATCTCGTCCCGT
TCGTGGGGCTGGGGATGGCCATACGTGACATCTTCAACCCGCCCGTGACCACACCGGCCAACCCAGGCTC
GGAGCCCGCTGAAGGAGACAAGATCAGCTGTTCGCGCCACCCGCCCCTGCCCGACACCTTCATTGCGCAA
GGCTCGGACAAGGTATTCATCAATGGCCAACCCGCAGCGCGTTCAGGTGACAAGACCACCTGCGATGCCA
CGATTGATGTGAATGAAAACGTATCGCCCAATGTGCGCATTGGTGGCGGTACGGCGACGGTCCGGGACAT
TCGCAACGGCAAGAGCAAGATTGCGATGTTTACCGGGATTATTGCGGGGATGCTTATCTCCCGAAGGTTT
GGCCGCATCAAAGGGTGCACATTAGGCAACCCGGTTGCTGTTGCCACCGGGAGCAAGCTGCAGGAGGGTC
CGGAGGACATCGACTTCAATCTCCCAGGCTTGCTGGCCATCCAATGGGCACGGCGCTACGACAGCAGGGA
CATGCGCAGCGACGGTCTACTGGGGATGGGTTGGAGTGTCCCCTATGAAGTGGAGCTGGCCCGCGTCCCA
CATCCTCAAGGCGGTACGCTGTGGATCTACATCGACAACGACGGTAACCGACTGGAACTGGGCCGCCTCA
GTGCCGGTGATGCCTTCATCAGTGCCGTGGACGGCTTGGCCTTCTTCCAGCTGGAGGACGGCCAGACCGT
TGTCGAAGATATCAATGAAGGGCTTTATCGGGTCTTCGATACCGACCCGCTGAATCCGAAACGCTCACGG
CTGATCAGGCTCGGCGACCGCAATCTCAATTGCCTCGACCTGCTGTACGACGAACAAGGGCGCCTGAAAG
CCCTCTATGACAAGTACGGCCAAACGGTCGTGCAGCTTCACTATGCCGCCAGGCATCCCCAGCGTGTCAG
TGAGGTATCACGGGTGTTCCTGAAAAACGGTGGAACACCTACGGTAGAACGCAGCGAACTGCTGGTCAGC
TATCGCTACACCGACAACGGGCAACTGCATGAGGTATTGGATGCGACGGATCAACGAGTCCGCCGCTTCA
CTTACACCCCCGAGGGCTATCTCAATAGCCATCAACTGGCTAGCGGTGCTGTCCGCGAATACGAATGGGC
GCGCTTCGCCATTCCTGAAACGCGCCCTACTCCCAAGCGCCTGGACGGCACGCCCTACCGCTTGCCTCCA
CTGCTGGAGCCCCAACCCGATCACGAATGGCGAGTGATTCGCCACTGGGGCAGCGATGGTGAAGAGTACC
GGTTCGAGTACAACCTGGAAGCCGGTGAAACCCTCGTCACGGACAACCTCGGCCGCCGTGATCACTACTA
CTGGGGGCCACTGTACGAGGTCTATAAGCACATCGACCCTCAGGGCAACTGCTGGCTGGCGGAAGTGATC
GCCGGACAGTTGATCAAGCGCATCGACCCGCAAGGAGGCGAATGGCGCTACAGCTACGACGATATCGGCC
GCCTGATCGAAACCCGCGATCCCCTCGGCCGCAGCGAACACATCAAATACCTACGACATTGGGCGCTACC
CATCCAGGTCACCGATACAGCCGGACGGACTCGGCAATACGGCTACGACAGCCACGGCAATCTGCTCTGG
CAGCAGGACCCGCTGGGGCGCGAGACACAGTACCAATACGACCCGGAAGGCCGTGTTACCCAGGTCACCG
ATGCCCTCGAAAAGAGCAAGTACCTGAGCTGGAACACGTGCGGTCAGTTGCTCAGCTACCGCGACTGCAG
CAATGCCCAGACGCTGTATCACTACGACGCCCATGGCCGCTTGCGCGAAAGCATCAATGCCCGGGGTGAA
CACACCCACTTCCGCTACGACGCACGTGGTTATCTGGTCGAAAGCGAACGCCCGGACGGTCGCATTGATC
GTTATGAAATTGATGTCGCTGGTCAACTGACGCGCTATATCGACCCTGCCCAGAAAACCCTGCAATTTCG
CTACGACCCCAGCGGCCGGCTGGTCGAACGCACGGACGCCATGGGCTACAGCGTGAAATTCCGCTACGAC
GCCTATGGTCGGCTACTGCAACTTACCAACGAGAATGACGAGTCATACCGCTTCGGCTGGGACGAACTGG
ACCGGCTGGTGGCACAAAAAGACCTGGATGGCAGTGGCCGCCTCTATGCCTACAACGTGCTGGATGAGGT
CATTCGTCTTACCCATGTGCCCTCGCCTGACGAGCAGCCGCCCCTGTCCGACAACGCCCCGCCGACACGG
ACGACTGCCATCCGCCATGACTTCGAGCGGGACGCCATCGGCCGGCTTGTCAGCAAGCGCACCGAAGATG
GCACCACCGACTACCGCTACGACGCGGCCGACAATCTGCTGTCCATCACCTTCACAGACAATAAAGGAGA
AAAACAGCAACTCGACTACACCTACGACGCCAACGGGCAACTGCTCAGCGAAACCAACAGCGCTGGCTTG
CTGCAGTACCGCTACGACGAACTGGGTAACCTGCAGACGCTAGTCCTGCCCGACCAACGCGAACTCAACC
ACCTGTACTACGGCAGCGGGCACCTGCACCAGATCAACCTGAACGGCCGGGTGATCAGCGATTTCGAGCG
TGATGCGGTGCACGACGAGGTCCTGCGGACCCAAGGCAAACTGGTCACCCGCACGCGCTACGACACCAGC
GGTCGCTTGGCCGGCAAGGCTATTCACTACCGCGATGCCCCTGCTGAAGTGCTGCCGCTGCTGGACAAGG
CCTATCGCTACGATGCCAGCGACAACCTGATTGCCGAGGTACTGACCCAGACACAGCGCCGAGGGATGTC
CAACGCTGCCAATGACGAAAACGCTAACCTCGAACAGATCATCGGTCGCTTCCTTGACCTACCCCACACG
GGCAAGACCTATTCGGGACACAACCGCTACGGCTACGACCTCAACGAGCAACTGCAGACCGTTCACCAGT
CACGCCCCAACTGGCAGGCCACGCAGGTCGAGGATTTCAAGTACGACAAGGCCGGCAACCTGTTCGACGG
CCCCAAACTCAATGGCCTGATCAAGCACAACCGGGTGTTGGTGTATCAGGACAAGCGCTATCGCTATGAC
CGCTTTGGGCGGCTGTGCGAGAAGCGGATCGGCAGCAATTGGGTGCAGTATTTCGAGTATGACGCCGAGC
AGCGGCTGGTTTGCGTGGAGCAGTACCGCAGTGGCGAGCGTGAGCGGGTGGTGTTTGCCTATGACCCGTT
GGGGAGGCGGATCAGCAAGGAGGTTTATCAGAGGGACTATCCAGAGCCGCGTCGGCGGGTGCTGTTTCAC
TGGCAAGGGTTTCGCTTGCTTCAAGAAGTGCAGAGTGGTTTGGCTAGCTTGTATGTGTATGCCACTGTGG
AGAGCTATGACCCGTTGGCGCGGGTTGACGGTAAACCTGGCAGCGAAGCAATTCACTATTTTCATACCAC
CTTGGTTGGGCAACCGGAGCAGCTGACTGATTCTGATGGCAACACGATCTGGCGTAGTGACCATCACGGT
TGGGGAAAGATAATTAATGAGTGGCACAGCCAACAAAATGGACGTGAACAAAACCTGCGAAATCAAGGCC
AATACATTGATCGCGAGACTGGGCTACACTTCAATATATTCAGATTTTACGACCCCGATATAGGCCGCTT
CACAACAACAGACCCTCTCGGGATCGAAGGAGGAGTCAATCTCTACAGCTACGCCCCAAATATAGTAAAC
TACTCAGATCCGCTTGGGCTCTGCCCCGAAAATGTCAAAGAATATGATATCACCCCATACAGGCCTAGCA
ATAGCCCCCTCGAAAACCATCATGGCATCCTAGATATCTGGGCGGCACAAAACGTGCCCTCATATGGAGG
AAAATATCCCAAAGGGTCTCCTACGATCGTATTGTCTAGTAAAAATCATGCAGCCACCAAGGCGGTGTAT
CGTGAGTGGCTAAGAGAAAAAACTGGAAAACCTGTGGGAGGCAAAGTAGATTGGTCGCAAATCAGCAATC
GAGAGGTCATGCAACTTTCGGAGCGAATGTTTGACGTCGCAGGAGTTCCAGCCACCAGCCGAACCTCCTA
CTACAGGGCATTGAATAGATATTTACACACAGGCACTTTCTGA
 Primer design