SecReT6
Protein ID: 271499865
SecReT6 ID373
T6SS typei1
Gene symbol-
Locus tagDd586_1303
StrainDickeya dadantii Ech586
Repliconchromosome [GenBank: NC_013592] [Browse all T6SS(s) in this replicon]
Location [Strand]1453794..1457291 [+]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDD2BW15
KEGG IDddc:Dd586_1303
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 5.10E-91, Aligned region: 505..819
IcmF-related [PF06761], Evalue: 5.10E-91, Aligned region: 884..923
ImcF-related_N [PF14331], Evalue: 1.20E-69, Aligned region: 201..458
DUF1215 [PF06744], Evalue: 2.50E-31, Aligned region: 757..780
DUF1215 [PF06744], Evalue: 2.50E-31, Aligned region: 905..1023
Protein Sequence: 1165 a.a.     [Download]
>gi|271499865|ref|YP_003332890.1| type VI secretion protein IcmF [Dickeya dadantii Ech586]
MLKIIITFLRQQLPKLKPSWLLLGVVVWVVALVLAWWLGPRLLLGEMRPLQSVWGRVVFTLVWLWLGFAY
SAWRVWRRVQQLRAERREQQTIEQDPLQVYVDSQQTFLDRWLQAFQTQLGKKALYAMPWYLAIGLSGSGK
SSLIHRANPANKLNPKLDAELREVAGGQQVNSWVGESAVIWDPSGHLLAQPEIGAEPSAGRHARLWQHLL
QWLSLNRRRQPLNGLVLTIDLSWLSQASVSERKAYAQVMRARLQEIAVNINTRLPLYVALTRLDMLRGFD
VVYRSLNREARQAVLGVTFTPQASHGKGWLEELERFWDEWITSLNNNLPEMLLTQSDSGVRNTLFTFVRQ
LAGLKDYVTEVLNETLATGDDRAFLVRGVYASSVYQQGVPFDAFAQSASRRYQLPEPINAAMRGESNTFF
VQKLFPEVIFPEASLAGENRLHSLYRRRRMSIGVTCMVLFGLAMIGSWHHFYRVNEEAGRNVLTKAQAFI
GTNELEGQAGYGYQQLPRLNLIRDATLSFGNYHERTPMLADLGLYQGDKIGPYVEGSYLQMLNQRFLPAV
MQGLLEDLNQAPAGSEQKLTILRVMRMLDDASGRNKTLVEQFMALRWQKAFPGQGKVQEQLMQHLDYALD
HTDWHQSREQKDTVAISTFAPFVDPIASAQRELSKLPMYQRVYQSLVMKATQVLPPDLALRDEVGPTFDS
VFSLRNDKAGTVPRLLTYPGFSDFYLKQDKTLLDLTALDAWVLGQRERAHLSEADRKEILRQVNDRYITD
YINQWQKALANIDVQPLESPEQALNILTDITGNDQPFQRVLTTVSDNTRIRKLADDENDTAQGINTRIGR
PFMTINAALSGRGEQGPLVQEVNQKLTDLYHYLDQIVNATDPGQAALKAVQARQGNKFADPVFALQQYAR
SLPSPLDRWVGQLAGESASLVTGLAMSSLNQEWLDKVVTPFNEKLADRYPFNPSSDKDVPLSEMERFFAA
GGTLDNFYQTNLKSIMEGGMLEGEGASVMQTDLVKQLDRATRIRQTLFNAQGSLEIHFVVEPVELTANKR
RSVLNLDGQLLEYSHGRRTKTPLVWPNSMRDGAESKLTLVPDDRERSPRSLSFTGPWAMFRLLTNGQLTQ
VNDNTFDVRFSLEQGGMTYRVYTDASHNPFAGGLFSQFKLPDSLY
 
Nucleotide Sequence: 3498 bp     [Download]
>gi|271498578|ref|NC_013592.1|:1453794-1457291 Dickeya dadantii Ech586 chromosome, complete genome
ATGTTGAAAATAATCATTACCTTTCTGCGGCAACAGCTGCCGAAACTGAAACCGTCCTGGCTGCTGTTGG
GGGTGGTGGTATGGGTAGTTGCGTTGGTGCTGGCTTGGTGGCTGGGGCCGCGTCTGCTGCTTGGCGAGAT
GCGCCCACTGCAAAGCGTGTGGGGTCGCGTGGTGTTCACGCTGGTCTGGCTGTGGCTGGGGTTTGCCTAC
AGTGCCTGGCGTGTCTGGCGTCGGGTACAGCAACTGCGTGCGGAACGCCGTGAACAGCAGACTATCGAGC
AAGACCCCTTGCAGGTATACGTTGATAGCCAGCAAACCTTTCTGGACCGTTGGCTACAGGCGTTTCAAAC
CCAGCTCGGCAAAAAGGCGTTGTACGCCATGCCCTGGTATCTGGCGATTGGTTTGTCCGGCAGCGGTAAA
AGCAGCCTGATCCATCGTGCTAACCCGGCCAATAAGCTCAACCCGAAGCTGGATGCGGAGTTGCGTGAAG
TCGCTGGCGGCCAGCAGGTGAACAGTTGGGTTGGTGAGTCAGCGGTTATCTGGGATCCGAGCGGTCACTT
GCTGGCGCAACCGGAGATCGGCGCAGAGCCGTCGGCCGGGCGTCACGCGCGTCTGTGGCAGCATCTGCTG
CAATGGCTGAGCCTCAACCGTCGTCGCCAGCCGCTCAACGGGCTGGTGCTGACTATCGACCTCTCCTGGT
TGTCGCAGGCCAGCGTGTCGGAGCGCAAGGCCTATGCGCAGGTGATGCGCGCCCGCCTGCAGGAGATTGC
GGTCAACATCAATACCCGTTTGCCGTTGTATGTGGCGCTGACCCGTCTGGACATGCTGCGCGGTTTTGAC
GTGGTGTACCGTTCGCTGAACCGGGAGGCACGTCAGGCGGTGTTGGGGGTGACGTTTACGCCACAGGCCA
GCCACGGCAAAGGCTGGCTGGAAGAGCTGGAGCGCTTCTGGGATGAGTGGATCACCAGCCTTAACAATAA
CCTGCCGGAAATGCTGCTGACGCAGTCGGACAGCGGTGTACGCAATACGCTGTTTACCTTCGTGCGTCAG
TTGGCCGGGCTTAAGGATTATGTGACGGAAGTGTTGAACGAAACACTGGCGACCGGCGACGACCGTGCAT
TTTTGGTACGCGGCGTTTACGCCAGTTCGGTGTATCAGCAGGGGGTGCCGTTTGACGCCTTCGCTCAGTC
GGCTTCGCGCCGTTACCAATTGCCGGAGCCGATTAATGCGGCGATGCGCGGCGAATCTAATACCTTCTTC
GTACAGAAACTGTTCCCAGAGGTGATTTTCCCGGAGGCCAGTCTGGCAGGGGAAAACCGGCTGCACAGCC
TCTATCGCCGTCGCCGCATGAGCATTGGGGTGACCTGCATGGTGCTGTTTGGGCTGGCGATGATCGGTAG
CTGGCACCATTTCTACCGGGTCAACGAAGAGGCCGGTCGTAACGTGCTGACCAAAGCGCAGGCGTTCATC
GGCACCAACGAGCTGGAAGGGCAGGCGGGATACGGCTACCAGCAGTTGCCGCGTTTGAATTTGATCCGCG
ACGCTACTCTGTCGTTCGGTAACTACCATGAACGTACGCCGATGCTGGCGGATCTTGGCCTGTATCAGGG
CGATAAGATTGGCCCCTACGTGGAAGGTTCGTACCTGCAAATGCTTAACCAGCGCTTCTTGCCTGCGGTG
ATGCAAGGGCTGCTGGAAGACCTGAATCAGGCTCCGGCGGGTAGTGAACAAAAGCTCACTATTTTGCGGG
TAATGCGGATGCTGGACGACGCCTCCGGGCGTAACAAGACGCTGGTGGAGCAGTTTATGGCGCTGCGCTG
GCAGAAGGCGTTCCCCGGTCAGGGCAAGGTGCAGGAACAACTGATGCAGCATCTGGATTACGCGCTGGAT
CATACCGACTGGCATCAGTCCCGCGAGCAAAAGGATACGGTGGCGATCTCGACGTTTGCACCGTTTGTCG
ACCCGATCGCCAGTGCCCAGCGCGAGCTGAGCAAGCTGCCGATGTACCAGCGTGTCTACCAGAGTCTGGT
GATGAAAGCGACGCAGGTGCTGCCGCCGGATCTGGCGCTCCGCGACGAGGTCGGGCCGACGTTTGACTCG
GTATTTAGTTTGCGTAATGACAAGGCAGGCACCGTACCCCGCTTGTTGACCTATCCCGGTTTCAGCGATT
TTTACCTCAAGCAGGATAAGACACTGCTGGACCTGACCGCGCTGGATGCCTGGGTATTGGGGCAGCGTGA
GCGTGCTCACCTGAGCGAGGCAGACCGTAAGGAAATTCTGCGGCAGGTGAATGACCGCTATATCACCGAC
TACATCAACCAGTGGCAAAAAGCGCTGGCGAATATCGATGTGCAGCCGTTGGAAAGCCCGGAGCAGGCGC
TGAACATACTGACCGACATTACCGGTAATGATCAGCCGTTCCAGCGGGTGCTGACCACGGTGAGTGACAA
CACCCGTATCCGCAAGCTGGCGGATGACGAGAACGACACCGCGCAAGGCATCAATACCCGTATTGGTCGT
CCGTTCATGACGATTAACGCCGCGTTGAGCGGGCGGGGTGAACAGGGGCCGCTGGTGCAGGAGGTCAATC
AGAAGCTGACCGATCTCTACCACTATCTCGATCAGATTGTGAATGCGACGGATCCGGGGCAGGCAGCACT
GAAAGCGGTGCAGGCGCGTCAGGGCAACAAGTTCGCTGACCCGGTGTTCGCGTTGCAGCAGTATGCTCGC
AGCCTGCCGTCGCCGCTCGATCGCTGGGTCGGTCAACTGGCGGGAGAAAGCGCCAGTCTGGTGACCGGTC
TTGCCATGTCGTCACTGAATCAGGAATGGCTGGACAAGGTGGTGACGCCGTTTAATGAAAAACTGGCGGA
TCGCTACCCGTTCAACCCATCCTCTGACAAGGATGTTCCGCTCTCCGAGATGGAACGCTTCTTCGCGGCT
GGTGGCACGCTGGATAACTTCTACCAGACCAACCTCAAATCCATCATGGAAGGCGGGATGCTGGAAGGGG
AAGGTGCGTCGGTAATGCAAACCGATCTGGTGAAACAGCTTGATCGCGCGACCCGTATCCGCCAGACGCT
GTTTAACGCACAAGGCAGCCTGGAAATCCACTTTGTGGTGGAACCGGTGGAACTGACCGCTAACAAGCGT
CGCAGTGTTCTGAACCTTGACGGACAGTTGCTGGAATACAGCCACGGACGCCGCACCAAAACGCCGCTGG
TGTGGCCGAACAGCATGCGTGACGGCGCTGAAAGCAAGCTGACGCTGGTGCCGGATGACCGCGAGCGCTC
GCCACGTAGCCTGAGCTTCACCGGACCGTGGGCCATGTTCCGCCTGTTGACCAACGGCCAGCTAACCCAG
GTCAACGACAATACGTTCGACGTGCGCTTCTCACTGGAACAAGGTGGCATGACCTATCGGGTGTATACCG
ATGCCAGCCATAACCCGTTTGCCGGTGGCCTGTTTAGCCAGTTCAAGCTGCCTGATTCTCTCTATTAA
 Primer design