SecReT6
Protein ID: 27366864
SecReT6 ID38
T6SS typei5
Gene symbol-
Locus tagVV2_0427
StrainVibrio vulnificus CMCP6
Repliconchromosome II [GenBank: NC_004460] [Browse all T6SS(s) in this replicon]
Location [Strand]460250..460540 [-]
Producthypothetical protein
NotePAAR
UniProt IDQ8D6U8
KEGG IDvvu:VV2_0427
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 3.80E-25, Aligned region: 1..17
PAAR_motif [PF05488], Evalue: 3.80E-25, Aligned region: 17..86
DUF4150 [PF13665], Evalue: 6.80E-08, Aligned region: 28..49
DUF4150 [PF13665], Evalue: 6.80E-08, Aligned region: 58..83
Protein Sequence: 96 a.a.     [Download]
>gi|27366864|ref|NP_762391.1| hypothetical protein VV2_0427 [Vibrio vulnificus CMCP6]
MGKPASVIGCFHVCPKKTGKIPHVGGPVVTGSPNVKIGGIPAAREGDKLICVGPPDSISSGSSSVKINGK
PAARMGDSTSHGGKILVGVPTVLIGD
 
Nucleotide Sequence: 291 bp     [Download]
>gi|326424156|ref|NC_004460.2|:c460540-460250 Vibrio vulnificus CMCP6 chromosome II, complete sequence
ATGGGTAAACCTGCATCTGTCATTGGTTGTTTTCACGTCTGTCCGAAAAAGACCGGGAAGATTCCCCATG
TTGGAGGCCCTGTCGTCACGGGCTCGCCGAATGTGAAAATAGGAGGTATACCTGCCGCGAGAGAAGGAGA
CAAGCTGATATGTGTTGGCCCTCCCGACAGTATTTCAAGCGGTTCATCGTCAGTAAAAATTAACGGCAAG
CCAGCCGCTCGGATGGGTGATAGCACTTCTCACGGTGGCAAAATATTGGTTGGCGTACCTACCGTGTTGA
TTGGAGATTAG
 Primer design